Protein Info for RR42_RS25195 in Cupriavidus basilensis FW507-4G11

Annotation: AMP-dependent synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00501: AMP-binding
  • amino acids 32 to 415 (384 residues), 282.8 bits, E=3.9e-88
• PF13193: AMP-binding_C
  • amino acids 466 to 540 (75 residues), 70.3 bits, E=2.3e-23

Best Hits

KEGG orthology group: K01897, long-chain acyl-CoA synthetase [EC: 6.2.1.3] (inferred from 91% identity to reu:Reut_C6065)

Predicted SEED Role

No annotation

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (50/53 steps found)
• superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
• palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
• oleate β-oxidation (29/35 steps found)
• fatty acid salvage (5/6 steps found)
• stearate biosynthesis II (bacteria and plants) (5/6 steps found)
• octane oxidation (4/5 steps found)
• long-chain fatty acid activation (1/1 steps found)
• palmitate biosynthesis III (21/29 steps found)
• phytol degradation (3/4 steps found)
• stearate biosynthesis IV (4/6 steps found)
• γ-linolenate biosynthesis II (animals) (1/2 steps found)
• linoleate biosynthesis II (animals) (1/2 steps found)
• alkane biosynthesis II (1/3 steps found)
• oleate biosynthesis I (plants) (1/3 steps found)
• 3-methyl-branched fatty acid α-oxidation (3/6 steps found)
• 6-gingerol analog biosynthesis (engineered) (3/6 steps found)
• long chain fatty acid ester synthesis (engineered) (1/4 steps found)
• phosphatidylcholine acyl editing (1/4 steps found)
• wax esters biosynthesis II (1/4 steps found)
• stearate biosynthesis I (animals) (2/6 steps found)
• ceramide degradation by α-oxidation (2/7 steps found)
• sphingosine and sphingosine-1-phosphate metabolism (4/10 steps found)
• arachidonate biosynthesis III (6-desaturase, mammals) (1/7 steps found)
• capsaicin biosynthesis (1/7 steps found)
• icosapentaenoate biosynthesis II (6-desaturase, mammals) (1/7 steps found)
• icosapentaenoate biosynthesis III (8-desaturase, mammals) (1/7 steps found)
• sporopollenin precursors biosynthesis (8/18 steps found)
• ceramide and sphingolipid recycling and degradation (yeast) (4/16 steps found)
• cutin biosynthesis (3/16 steps found)
• suberin monomers biosynthesis (5/20 steps found)

KEGG Metabolic Maps

• Fatty acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.2.1.3

Use Curated BLAST to search for 6.2.1.3

Sequence Analysis Tools

See A0A0C4YHL2 at UniProt or InterPro

Protein Sequence (557 amino acids)

>RR42_RS25195 AMP-dependent synthetase (Cupriavidus basilensis FW507-4G11)
MEARRWHSSYPAGIPLDIEVDATATLGPMIARAVASFATRPAVTCLEESLSYAEFGILSE
ALATFLQQSGLKKGDRVALMLPSCPAFLIGLAAVFQAGMVAVPVNPLYTPRELKHQLQDS
GATCIIVADQLQQSLQQVLEETSIVQVLTAPVVGMKPIAVQLAALAKDAGAVQHAGTTGG
RTCQPLAHAILQGSRGSLSPVAQTAQDIAILQYTGGTTGVSKGAVLTHKSVCASLAQVST
WVGPPLAGSEASMVTPLPLYHIFPLATALLALLLGCENRLVPNPREAGAVLAELKRRPFQ
IFIGVNTLFNSLVNTPELISVDFSATRLVIGAGASIQDAIAKRWLAAGAPPVTEAYGLTE
TSPSATFNPPGRSGTIGIPAPSTDVRLVDESGHDVPLGVAGELLIKGPQLFSGYWNQDDE
TRKAFLDGGWFRTGDIVVMDELGFMTMVDRKKDMILVSGFNVYPNEIEAVVAMMPDVLEA
ACIGVPDERSGEAPHLFIVPRNMALTTEQVEAHCRSHLAAYKVPRHITLIDALPKSTVGK
ILRRDLRSRLVAEQSNA