Protein Info for RR42_RS25190 in Cupriavidus basilensis FW507-4G11

Annotation: acyl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 589 PF12418: AcylCoA_DH_N" amino acids 4 to 21 (18 residues), 29.7 bits, see alignment (E = 1.6e-10) PF02771: Acyl-CoA_dh_N" amino acids 40 to 156 (117 residues), 49.1 bits, see alignment E=2e-16 PF02770: Acyl-CoA_dh_M" amino acids 161 to 270 (110 residues), 47.3 bits, see alignment E=5.5e-16 PF00441: Acyl-CoA_dh_1" amino acids 281 to 446 (166 residues), 79.4 bits, see alignment E=9.9e-26 PF08028: Acyl-CoA_dh_2" amino acids 296 to 441 (146 residues), 32 bits, see alignment E=3.9e-11 PF12806: Acyl-CoA_dh_C" amino acids 464 to 587 (124 residues), 97.9 bits, see alignment E=1.4e-31

Best Hits

KEGG orthology group: K00257, [EC: 1.3.99.-] (inferred from 96% identity to reu:Reut_C6066)

Predicted SEED Role

"Acyl-CoA dehydrogenase (EC 1.3.8.7)" (EC 1.3.8.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.8.7, 1.3.99.-

Use Curated BLAST to search for 1.3.8.7 or 1.3.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YAH1 at UniProt or InterPro

Protein Sequence (589 amino acids)

>RR42_RS25190 acyl-CoA dehydrogenase (Cupriavidus basilensis FW507-4G11)
MNYYHAPVRDLQFVLHELLDVSAGSPIAEIADPDTINQVIEAAGQFATEILAPLNGIGDR
QGCTMPSSGVVTTPDGFKNAYKQFSEAGWTALACQSEHGGQGLPNAVNAAVMEIFAGANM
AWAAYPGMSQAAYTCLAANGSDAQRALYLPKLASGEWAGTMCLTEPHCGTDLGLLRTRAV
PNADGTFGITGTKIFISGGEHDFTDNIVHLVLARLPDSPPGVKGISLFLVPKFLVSPEGD
LAERNAVTCGSLEHKMGIHANATCTMNFDGAAGYLVGEPDKGLAAMFVMMNHARLLVGVN
AIGLMEAAYQKALGYAKDRTQGRSPTASTRNVPADPIIEHADVRRMLLTQKAYVEGTRAF
AQWACQLADTQHFADDSGVRHQAAELSALVTPIVKAFSSDLAVECTSLAMQVFGGHGYIV
DNQVEQHLRDARIIPLYEGANGIQAMDFLGRKVLPDQGTRLEMFLAIVTEFIDANANNPV
LREFTAPLSSATEVLRNATHEVLMQAKTDPHVLGSVAASYLRLAGHVGLAWMWARMAAIG
LVNPASADPIYASKVATARFYFKKLLPEIHSLAAAIAAGSGPIMELDFG