Protein Info for RR42_RS24640 in Cupriavidus basilensis FW507-4G11

Annotation: amine oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01409: Tat (twin-arginine translocation) pathway signal sequence
  • amino acids 17 to 44 (28 residues), 18.2 bits, see alignment (E = 1.2e-07)
• PF01266: DAO
  • amino acids 57 to 94 (38 residues), 28.5 bits, 2.3e-10
• PF00890: FAD_binding_2
  • amino acids 57 to 94 (38 residues), 23 bits, 9e-09
• PF13450: NAD_binding_8
  • amino acids 59 to 126 (68 residues), 41.9 bits, E=2e-14
• PF01593: Amino_oxidase
  • amino acids 64 to 486 (423 residues), 167.2 bits, E=1.6e-52

Best Hits

KEGG orthology group: K00274, monoamine oxidase [EC: 1.4.3.4] (inferred from 95% identity to rpf:Rpic12D_4452)

Predicted SEED Role

"Amine oxidase [flavin-containing] (EC 1.4.3.4)" (EC 1.4.3.4)

MetaCyc Pathways

• superpathway of phenylethylamine degradation (9/11 steps found)
• phenylethylamine degradation I (2/2 steps found)
• L-tryptophan degradation X (mammalian, via tryptamine) (3/4 steps found)
• salidroside biosynthesis (3/4 steps found)
• L-tryptophan degradation VI (via tryptamine) (2/3 steps found)
• L-phenylalanine degradation IV (mammalian, via side chain) (6/9 steps found)
• phenylethanol biosynthesis (3/5 steps found)
• putrescine degradation III (2/4 steps found)
• serotonin degradation (4/7 steps found)
• noradrenaline and adrenaline degradation (8/13 steps found)
• dopamine degradation (2/5 steps found)
• melatonin degradation II (1/4 steps found)
• aromatic biogenic amine degradation (bacteria) (3/8 steps found)
• superpathway of melatonin degradation (3/11 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Arginine and proline metabolism
• Drug metabolism - cytochrome P450
• Glycine, serine and threonine metabolism
• Histidine metabolism
• Phenylalanine metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Urea cycle and metabolism of amino groups

Isozymes

Compare fitness of predicted isozymes for: 1.4.3.4

Use Curated BLAST to search for 1.4.3.4

Sequence Analysis Tools

See A0A0C4YA65 at UniProt or InterPro

Protein Sequence (498 amino acids)

>RR42_RS24640 amine oxidase (Cupriavidus basilensis FW507-4G11)
MDDIPTKRDETPEAAALTRRGFLGMAASVTAAATVAVLPKVASAAIAASDERDVLEVVVI
GAGLAGLTAARDLKRAGCESFVVLEARDRVGGRTLNHDLGNGYFSESGGQWIGPGQTAVA
DLARELGVGTFPTYWQGKTMMLAGDAHAAVDTEGGFGTDPKIAHELEELAKSVPCGAPWK
SPRAAEFDAMSVGDWLVKKNIANADQIGWSTGLAITGGASPARLSLLHWLSMVNSAECNY
DRLEAVKGGAQQTRISGGSQILSIKMAQALGDKVRLSTPVLRVENWQNGPVAIHTANGVV
RARNVIVALAPMLCNQIAFDPPLPEKRHEMQRRWPAFAPGRKTTHVYKKAFWRDRGLNGW
IFQPGGPVLWAYDNSPEDVSFGVINAFVHISMLPADPKEAEAQLSQIYAQAFGDQALHPI
AFHQRDWLKADKWTLSCVSPMPPGFLTTYGEALHPSVGKLIWSGTETAEIWAGYMDGAVR
SGHKAALQALQAVAGREA