Protein Info for RR42_RS23735 in Cupriavidus basilensis FW507-4G11

Updated annotation (from data): phenylacetyl-CoA 1,2-epoxidase, structural subunit (EC 1.14.13.149)
Rationale: Specific phenotype: utilization of L-Leucine, Phenylacetic acid. The mild phenotype on leucine is not explained.
Original annotation: phenylacetic acid degradation protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 PF05138: PaaA_PaaC" amino acids 3 to 266 (264 residues), 307.3 bits, see alignment E=3.9e-96 TIGR02158: phenylacetate-CoA oxygenase, PaaI subunit" amino acids 13 to 266 (254 residues), 284.9 bits, see alignment E=3.2e-89

Best Hits

KEGG orthology group: K02611, phenylacetic acid degradation protein (inferred from 78% identity to bug:BC1001_3301)

Predicted SEED Role

"Phenylacetate-CoA oxygenase, PaaI subunit"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.149

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y9Q1 at UniProt or InterPro

Protein Sequence (266 amino acids)

>RR42_RS23735 phenylacetyl-CoA 1,2-epoxidase, structural subunit (EC 1.14.13.149) (Cupriavidus basilensis FW507-4G11)
MTTPQHLSYVLRLADNALILGQRNSEWCSQGPALEEDIALANISLDLIGQARLLYSHAAT
LDEALNGARKTEDSYAYFRAEREFANYTLVELPHFGPLAGTARAERDYAVTITRNFLYSA
LMGHLWTALQSSTDTHLAAIAAKSLKETRYHLTHAADWLIRFGDGTEESHRRAQAALDYL
MPYTREFFAADAVETAVAAAGIGPLMADLQPAWQADVAATVAQATLTLPSEAKHITTGKH
GEHSEHMGYLLSEMQSLARQHPGATW