Protein Info for RR42_RS23665 in Cupriavidus basilensis FW507-4G11

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 693 transmembrane" amino acids 13 to 34 (22 residues), see Phobius details amino acids 195 to 214 (20 residues), see Phobius details PF02203: TarH" amino acids 4 to 172 (169 residues), 38.1 bits, see alignment E=3.1e-13 PF12729: 4HB_MCP_1" amino acids 6 to 189 (184 residues), 73.9 bits, see alignment E=2.5e-24 PF00672: HAMP" amino acids 214 to 263 (50 residues), 35.9 bits, see alignment 1.5e-12 PF00015: MCPsignal" amino acids 328 to 484 (157 residues), 179 bits, see alignment E=1.5e-56

Best Hits

KEGG orthology group: K05874, methyl-accepting chemotaxis protein I, serine sensor receptor (inferred from 63% identity to rme:Rmet_5250)

Predicted SEED Role

"Methyl-accepting chemotaxis protein I (serine chemoreceptor protein)" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y9N9 at UniProt or InterPro

Protein Sequence (693 amino acids)

>RR42_RS23665 histidine kinase (Cupriavidus basilensis FW507-4G11)
MRWLRNFGIGVRLTVAFSLVALLLIAVAVLGMMSLRTMNESMRLTVEGRLFKVLEIERVK
QDALRTGILVRDATLNEDPVAVRRDAERIGALRQDMRGTLDELGKWLSRSAKPEIQETYR
ALVEARNAYDTQLDTVLRQLQGGEFDSARSALVATLPAAQAPYFDKLSELSDGGRKVAAA
AVQEANASYEMARNLLLGLAAAAVALAAVLGIGITRSITRPARQALDAAQALAHGNLTYV
IDASSDDEMGRMLGALERAFGQLATLVHGIQGATRSIDGATREIAKGNTDLSQRTEEQAA
SLEQTAASMEQLTSTVKQNAANARHANELAVSASGVATAGGHAVRGVVETMQHISQSSAK
VAEIVGVIEGIAFQTNILALNAAVEAARAGEQGRGFGVVAAEVRSLAQRSSSAAKEIGQL
INGSVGQVAHGAKQVEDAGRTMDDIVGAVKRVTDIMGEIAAASEEQSCGIEQVNRAINQM
ESVTQQNAALVEQAAAAAESLQQQAAGLVDDVSRFQVTPAQTHVARAPAPAPALTVPARA
VAAARVAPAAAGRRPAAHTAAGGKSHPPARPGAARPTPARPVAPAARAAQAVQVVQAASA
ARVAPATAAKPAARPAAVAPRAGAVRTTREPVLPSKARAPVVRQGREPVLSSKALPAARQ
AKPAGVAAAVPRRAARTPAAGSPAVAAGDWESF