Protein Info for RR42_RS23595 in Cupriavidus basilensis FW507-4G11

Annotation: dTDP-4-dehydrorhamnose 3,5-epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 181 TIGR01221: dTDP-4-dehydrorhamnose 3,5-epimerase" amino acids 3 to 176 (174 residues), 166.3 bits, see alignment E=3e-53 PF00908: dTDP_sugar_isom" amino acids 6 to 175 (170 residues), 200.3 bits, see alignment E=9.4e-64

Best Hits

Swiss-Prot: 44% identical to RMLC_METTH: dTDP-4-dehydrorhamnose 3,5-epimerase (rmlC) from Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)

KEGG orthology group: K01790, dTDP-4-dehydrorhamnose 3,5-epimerase [EC: 5.1.3.13] (inferred from 70% identity to cti:RALTA_B2139)

Predicted SEED Role

"dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13)" in subsystem Capsular heptose biosynthesis or Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 5.1.3.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.13

Use Curated BLAST to search for 5.1.3.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YNM6 at UniProt or InterPro

Protein Sequence (181 amino acids)

>RR42_RS23595 dTDP-4-dehydrorhamnose 3,5-epimerase (Cupriavidus basilensis FW507-4G11)
MMFTRTPIEGAWLVDPEPLADERGFFARTACVDAFADHGLNGRFVQQSISRNTRAGILRG
MHLQYEPAGEDKLVRVTTGAIFDAILDLRPYSPSYRQWFSVELTAQNQRALYIPRGVAHG
FQTLTDLSEVFYQMTVPFAPAHSGGVRWDDPEIGIAWPPCQNRLISAKDMALPSLTALSA
Y