Protein Info for RR42_RS23500 in Cupriavidus basilensis FW507-4G11

Annotation: benzene 1,2-dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 TIGR03229: benzoate 1,2-dioxygenase, large subunit" amino acids 15 to 447 (433 residues), 900.5 bits, see alignment E=8.3e-276 PF00355: Rieske" amino acids 52 to 135 (84 residues), 78.2 bits, see alignment E=3.7e-26 PF00848: Ring_hydroxyl_A" amino acids 202 to 393 (192 residues), 66.1 bits, see alignment E=4.2e-22

Best Hits

Swiss-Prot: 75% identical to BENA_ACIAD: Benzoate 1,2-dioxygenase subunit alpha (benA) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: K05549, benzoate 1,2-dioxygenase alpha subunit [EC: 1.14.12.10] (inferred from 88% identity to rsc:RCFBP_11862)

MetaCyc: 67% identical to XylX (Pseudomonas putida mt-2)

Predicted SEED Role

"Benzoate 1,2-dioxygenase alpha subunit (EC 1.14.12.10)" in subsystem Benzoate degradation (EC 1.14.12.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.12.10

Use Curated BLAST to search for 1.14.12.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YHT3 at UniProt or InterPro

Protein Sequence (462 amino acids)

>RR42_RS23500 benzene 1,2-dioxygenase (Cupriavidus basilensis FW507-4G11)
MIPIYPDHSPALKRLDDYLVENRETGDHRLHRSAFTDEALFELEMKHIFEGNWIYLAHES
QIPGNNDYYTTYIGRQPIVIARNRQGELNALINACTHRGAMLCRHKRGNKATYTCPFHGW
TFNNSGKLLKVKDPEGAGYPDCFNKEASHDLKKVARFENYRGFLFGSLNPDVAPLKDFLG
EAAKIIDMIVDQSADGLEVLRGASTYTFEGNWKLQTENGADGYHVSAVHWNYAATTNHRK
QENAREDKIRAMDAGNWGRQGGGFYAFDHGHMLLWSRWANPEDRPNFNRREEFAERCGAE
TADWMIQNSRNLCLYPNVYLMDQFGSQIRVLRPLSVDKTEVTIYCIAPKGEADDARARRI
RQYEDFFNVSGMATPDDLEEFRACQQGYAGSAVAWNDMCRGATHWVEGADEAARKIGLKP
LMSGVKTEDEGLYTVQHRYWLDVMKKATGAEASKISSAGSEA