Protein Info for RR42_RS23495 in Cupriavidus basilensis FW507-4G11
Annotation: benzene 1,2-dioxygenase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 77% identical to BENB_ACIAD: Benzoate 1,2-dioxygenase subunit beta (benB) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
KEGG orthology group: K05550, benzoate 1,2-dioxygenase beta subunit [EC: 1.14.12.10] (inferred from 86% identity to bge:BC1002_6179)MetaCyc: 64% identical to XylY (Pseudomonas putida mt-2)
Benzoate 1,2-dioxygenase. [EC: 1.14.12.10]
Predicted SEED Role
"Benzoate 1,2-dioxygenase beta subunit (EC 1.14.12.10)" in subsystem Benzoate degradation (EC 1.14.12.10)
MetaCyc Pathways
- mandelate degradation to acetyl-CoA (15/18 steps found)
- meta cleavage pathway of aromatic compounds (9/10 steps found)
- benzoate degradation I (aerobic) (2/2 steps found)
- superpathway of aromatic compound degradation via 3-oxoadipate (25/35 steps found)
- toluene degradation IV (aerobic) (via catechol) (9/13 steps found)
- superpathway of aerobic toluene degradation (19/30 steps found)
- superpathway of aromatic compound degradation via 2-hydroxypentadienoate (21/42 steps found)
KEGG Metabolic Maps
- Benzoate degradation via CoA ligation
- Benzoate degradation via hydroxylation
- Fluorobenzoate degradation
Isozymes
Compare fitness of predicted isozymes for: 1.14.12.10
Use Curated BLAST to search for 1.14.12.10
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A0C4YJT2 at UniProt or InterPro
Protein Sequence (160 amino acids)
>RR42_RS23495 benzene 1,2-dioxygenase (Cupriavidus basilensis FW507-4G11) MGLAGIQAFLYRESRLLDDEQWDEWLACYHPDAAFWMPSWDDDDTLVTDPQREISLIYYP NRQGLEDRVFRIKTERSSATMPDTRTSHNISNVELERQEGSVCTVRFNWHTLSHRYKTNY SYFGMSRYVIDFAGEQAQILDKYVVLKNDYINQVIDIYHI