Protein Info for RR42_RS23495 in Cupriavidus basilensis FW507-4G11

Annotation: benzene 1,2-dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13577: SnoaL_4
  • amino acids 5 to 101 (97 residues), 24.1 bits, E=3.1e-09
• TIGR03232: benzoate 1,2-dioxygenase, small subunit
  • amino acids 6 to 160 (155 residues), 300.3 bits, E=1.3e-94
• PF00866: Ring_hydroxyl_B
  • amino acids 12 to 153 (142 residues), 167.2 bits, E=2.5e-53

Best Hits

Swiss-Prot: 77% identical to BENB_ACIAD: Benzoate 1,2-dioxygenase subunit beta (benB) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: K05550, benzoate 1,2-dioxygenase beta subunit [EC: 1.14.12.10] (inferred from 86% identity to bge:BC1002_6179)

MetaCyc: 64% identical to XylY (Pseudomonas putida mt-2)
Benzoate 1,2-dioxygenase. [EC: 1.14.12.10]

Predicted SEED Role

"Benzoate 1,2-dioxygenase beta subunit (EC 1.14.12.10)" in subsystem Benzoate degradation (EC 1.14.12.10)

MetaCyc Pathways

• mandelate degradation to acetyl-CoA (15/18 steps found)
• meta cleavage pathway of aromatic compounds (9/10 steps found)
• benzoate degradation I (aerobic) (2/2 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (25/35 steps found)
• toluene degradation IV (aerobic) (via catechol) (9/13 steps found)
• superpathway of aerobic toluene degradation (19/30 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (21/42 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Benzoate degradation via hydroxylation
• Fluorobenzoate degradation

Isozymes

Compare fitness of predicted isozymes for: 1.14.12.10

Use Curated BLAST to search for 1.14.12.10

Sequence Analysis Tools

See A0A0C4YJT2 at UniProt or InterPro

Protein Sequence (160 amino acids)

>RR42_RS23495 benzene 1,2-dioxygenase (Cupriavidus basilensis FW507-4G11)
MGLAGIQAFLYRESRLLDDEQWDEWLACYHPDAAFWMPSWDDDDTLVTDPQREISLIYYP
NRQGLEDRVFRIKTERSSATMPDTRTSHNISNVELERQEGSVCTVRFNWHTLSHRYKTNY
SYFGMSRYVIDFAGEQAQILDKYVVLKNDYINQVIDIYHI