Protein Info for RR42_RS23485 in Cupriavidus basilensis FW507-4G11

Annotation: 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 10 to 193 (184 residues), 169.8 bits, E=5.2e-54
• PF13561: adh_short_C2
  • amino acids 16 to 258 (243 residues), 150 bits, E=8.4e-48

Best Hits

Swiss-Prot: 66% identical to BEND_ACIAD: 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase (benD) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: K05783, 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase [EC: 1.3.1.25] (inferred from 82% identity to bph:Bphy_5349)

MetaCyc: 82% identical to 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase subunit (Ralstonia eutropha JMP222)
1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase. [EC: 1.3.1.25]; 1.3.1.- [EC: 1.3.1.25]; 1.3.1.- [EC: 1.3.1.25]

Predicted SEED Role

"1,2-dihydroxycyclohexa-3,5-diene-1-carboxylate dehydrogenase (EC 1.3.1.25)" in subsystem Benzoate degradation or Phenylpropionate Degradation (EC 1.3.1.25)

MetaCyc Pathways

• mandelate degradation to acetyl-CoA (15/18 steps found)
• meta cleavage pathway of aromatic compounds (9/10 steps found)
• benzoate degradation I (aerobic) (2/2 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (25/35 steps found)
• toluene degradation IV (aerobic) (via catechol) (9/13 steps found)
• 3-chlorobenzoate degradation I (via chlorocatechol) (2/4 steps found)
• superpathway of aerobic toluene degradation (19/30 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (21/42 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Benzoate degradation via hydroxylation
• Fluorobenzoate degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.1.25

Sequence Analysis Tools

See A0A0C4Y9L2 at UniProt or InterPro

Protein Sequence (261 amino acids)

>RR42_RS23485 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase (Cupriavidus basilensis FW507-4G11)
MNNNARFSGKIAVVTGAAQGIGRGVALAAAAEGASLVLVDRAALVHEVAAQIHANGGQAL
AVEADLETYAGACLMTSAALQAHGRIDVLVNNVGGTIWAKPYQEYEEAQIEAEIRRSLFP
TLWCCRAVLPGMIERKQGVIVNVSSIATRSIYRVPYAAAKGGVNALTASLAFEHAQDGIR
VNAIATGGTEAPPRKVPRNTAEQTPQEAAWYQGIVDQTMASSLMHRYGTIDEQVRAILFL
ASDEASYITGTVLPVGGGDLG