Protein Info for RR42_RS23340 in Cupriavidus basilensis FW507-4G11

Annotation: RNA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 PF01139: RtcB" amino acids 33 to 408 (376 residues), 445.4 bits, see alignment E=1.3e-137

Best Hits

Swiss-Prot: 68% identical to RTCB_ECOLI: RNA-splicing ligase RtcB (rtcB) from Escherichia coli (strain K12)

KEGG orthology group: K14415, protein RtcB (inferred from 81% identity to reu:Reut_B5869)

MetaCyc: 68% identical to RNA-splicing ligase (Escherichia coli K-12 substr. MG1655)
RXN-17905 [EC: 6.5.1.8]; 6.5.1.8 [EC: 6.5.1.8]

Predicted SEED Role

"Protein RtcB" in subsystem RNA 3'-terminal phosphate cyclase

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.5.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y9H7 at UniProt or InterPro

Protein Sequence (408 amino acids)

>RR42_RS23340 RNA ligase (Cupriavidus basilensis FW507-4G11)
MSKENYDVFLSGTGRPVKMWTHGVPVDDGARAQLANTAQMPFIFKHLAVMPDVHLGKGST
IGSVIPTRGAIIPAAVGVDIGCGMIAVKTTLTASDLPDSLGPLRSAIEKAVPHGRSSNRS
GRDKGAWGAVPDAVDASWAALAGGFERITRKYPKLARTNNRNHLGTLGTGNHFIEVCLDE
SQSVWFMLHSGSRGVGNAIGNTFIELAQADMRRHFINLPDRDLAYLVEGSEHYEDYVFAV
EWAQQYARRNRETMMANVLDAARAVIGKPFATEMEAVNCHHNYVQKERHFGEDVLITRKG
AVSAKAGELGIIPGSMGARSYIVRGKGNAESFCSCSHGAGRTMSRSEAKRRFSVEDQRLA
TQGVECRKDAEVIDEIPMAYKDIDAVMAAQSDLVEIVHTLKQVVCVKG