Protein Info for RR42_RS23185 in Cupriavidus basilensis FW507-4G11

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 33 to 53 (21 residues), see Phobius details amino acids 74 to 94 (21 residues), see Phobius details amino acids 101 to 121 (21 residues), see Phobius details amino acids 128 to 146 (19 residues), see Phobius details amino acids 152 to 169 (18 residues), see Phobius details amino acids 181 to 202 (22 residues), see Phobius details amino acids 212 to 236 (25 residues), see Phobius details amino acids 245 to 262 (18 residues), see Phobius details amino acids 268 to 285 (18 residues), see Phobius details PF00892: EamA" amino acids 9 to 144 (136 residues), 54.2 bits, see alignment E=9.2e-19 amino acids 154 to 283 (130 residues), 35 bits, see alignment E=7.8e-13

Best Hits

KEGG orthology group: None (inferred from 75% identity to rpi:Rpic_1582)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YNF6 at UniProt or InterPro

Protein Sequence (349 amino acids)

>RR42_RS23185 membrane protein (Cupriavidus basilensis FW507-4G11)
MTIRTAAPALAAALLFGASTPLAKALTGSIPPLLLAGLLYLGSGLGLGILLALRRSMSGA
ATSPLTVPRQETPWLLGAILAGGVAGPALLMTGLASTSAASASLLLNVEGVFTALIAWVV
FRENASRHIVLGMLAIVAGGLLLSWQPGSLRLSAGALLIVGACLCWAIDNNLTRKVSSND
AMLIACIKGLVAGVCNTGLALAGGDHLPALPALGAAMIIGFLGYGVSLALFVIALRLLGT
ARTGAYFSVAPLFGVVIAFGMWPQAPQPAFYVAALLMALGVWLHLREHHEHEHSHEATEH
SHAHRHDAHHQHEHAFDWDGKEPHRHLHRHEPLVHKHPHYPDTHHRHSH