Protein Info for RR42_RS22820 in Cupriavidus basilensis FW507-4G11

Annotation: lysine transporter LysE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 209 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 43 to 66 (24 residues), see Phobius details amino acids 75 to 93 (19 residues), see Phobius details amino acids 155 to 178 (24 residues), see Phobius details amino acids 190 to 208 (19 residues), see Phobius details PF01810: LysE" amino acids 17 to 206 (190 residues), 105.8 bits, see alignment E=1e-34

Best Hits

KEGG orthology group: None (inferred from 65% identity to bac:BamMC406_5170)

Predicted SEED Role

"L-lysine permease" in subsystem Lysine degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YGE3 at UniProt or InterPro

Protein Sequence (209 amino acids)

>RR42_RS22820 lysine transporter LysE (Cupriavidus basilensis FW507-4G11)
MVSIHLLVTFIGALAVVYALPGPDMALVLQTSTGRGVRHGLATVAGLAMARAAHVTLSAC
GVAALLRAAPWLYQGIRVAGGLYLAYVAIQIFRSPAFGMHAGTGTAVAPVRLRASVAKGA
LSSILNPKALLFCSVLLPQFVDPHGAPVWSQVLELGVVLVLTGVAFDLACVFGALRLTGW
LRRSPRAQTVQRWSFSAMLLAFAARISFE