Protein Info for RR42_RS22730 in Cupriavidus basilensis FW507-4G11

Annotation: pyridine nucleotide-disulfide oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 47% identical to Y1812_MYCTU: NADH dehydrogenase-like protein Rv1812c (Rv1812c) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K03885, NADH dehydrogenase [EC: 1.6.99.3] (inferred from 70% identity to reh:H16_A1765)

Predicted SEED Role

"NADH dehydrogenase (EC 1.6.99.3)" in subsystem Carboxysome or Respiratory dehydrogenases 1 (EC 1.6.99.3)

MetaCyc Pathways

aerobic respiration III (alternative oxidase pathway) (3/3 steps found)
NADH to cytochrome bo oxidase electron transfer I (2/2 steps found)
aerobic respiration I (cytochrome c) (3/4 steps found)
NADH to cytochrome bd oxidase electron transfer I (1/2 steps found)
NAD(P)/NADPH interconversion (3/6 steps found)
Fe(II) oxidation (2/6 steps found)

KEGG Metabolic Maps

Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.99.3

Use Curated BLAST to search for 1.6.99.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YH27 at UniProt or InterPro

Protein Sequence (401 amino acids)

>RR42_RS22730 pyridine nucleotide-disulfide oxidoreductase (Cupriavidus basilensis FW507-4G11)
MAKRILIIGAGFAGMWSALGAARLIDLHGQKDVEIALIAPQPELHVRPRFYEAGAARMKA
PLRDIFDAVGVRFIQGTVERIHADRNEVEVVGIDQARSTLSYDRLVLATGSRLFRPQIPG
LDKHAFSVDQIDEAAELEAHIKRLADHPASAARNTIVVAGGGFTGIETAAEMPARLRDAL
GEDAEVNVIVVDRHAEVAAELGAGPRPVITQALEALGVTWRPGTSVASVDENGLTTAHGE
RIDAKTVIWTAGVRASALTQQIPAQRDAFGRLHVDSNLRVKGVDAVFATGDVAYAATDDD
GNYAAMSCQHAMNLGRSAGHNVAADLLGLAPIPYRQPRYVTCLDLGPWGAVYTEGWEREV
KLVGADAKALKGRINAEWIYPPSADRAQALAAANPDRTVVA