Protein Info for RR42_RS22655 in Cupriavidus basilensis FW507-4G11

Annotation: mandelate racemase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 385 PF02746: MR_MLE_N" amino acids 48 to 143 (96 residues), 49.9 bits, see alignment E=3.6e-17 PF13378: MR_MLE_C" amino acids 169 to 368 (200 residues), 216.4 bits, see alignment E=4e-68

Best Hits

Swiss-Prot: 66% identical to TAGAD_SALTY: L-talarate/galactarate dehydratase (STM3697) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 82% identity to reu:Reut_B4643)

Predicted SEED Role

"L-talarate dehydratase @ Galactarate dehydratase (EC 4.2.1.42)" (EC 4.2.1.42)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.42

Use Curated BLAST to search for 4.2.1.42

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YGA5 at UniProt or InterPro

Protein Sequence (385 amino acids)

>RR42_RS22655 mandelate racemase (Cupriavidus basilensis FW507-4G11)
MTTQHQPKTGANDNIASIRLSSVYLPLATPISDAKVLTGRQKPMTEIAILFAEIETEGGD
KGLGFSYAKRAGGPGQFAHAREIAPALIGEDANDIARLWNKLIWAGASVGRSGLATQAIG
AFDVALWDLKARRANLPLAKLLGAHRDSVKCYNTSGGFLHTPLDQLLMNASKSVEKGIGG
IKLKVGQPDCAADIQRVETVRKHLGDGFALMVDANQQWDRPTAQRMCRILEQFNLIWIEE
PLDAYDSEGHAALAAQFDTPIATGEMLTSVAEHWDLIRHRAADYLMPDGPRVGGITPFLT
VATLADHAGLMIAPHFAMELHVHLAAAYPREPWVEHFEWLEPLFNERLEIKDGRMLVPTR
PGIGVSLSGQVAGWTREQAEFGAKR