Protein Info for RR42_RS21940 in Cupriavidus basilensis FW507-4G11

Updated annotation (from data): 4-hydroxybenzoate 3-monooxygenase (EC 1.14.13.2)
Rationale: Specifically important for utilizing 4-Hydroxybenzoic Acid. Automated validation from mutant phenotype: the predicted function (1.14.13.2) was linked to the condition via a SEED subsystem. This annotation was also checked manually.
Original annotation: 4-hydroxybenzoate 3-monooxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 389 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR02360: 4-hydroxybenzoate 3-monooxygenase" amino acids 1 to 389 (389 residues), 661.9 bits, see alignment E=1.4e-203 PF01494: FAD_binding_3" amino acids 2 to 342 (341 residues), 329.4 bits, see alignment E=3e-102

Best Hits

Swiss-Prot: 65% identical to PHHY_PSEAE: p-hydroxybenzoate hydroxylase (pobA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00481, p-hydroxybenzoate 3-monooxygenase [EC: 1.14.13.2] (inferred from 81% identity to rme:Rmet_4018)

MetaCyc: 65% identical to p-hydroxybenzoate hydroxylase (Pseudomonas fluorescens)
4-hydroxybenzoate 3-monooxygenase. [EC: 1.14.13.2]

Predicted SEED Role

"P-hydroxybenzoate hydroxylase (EC 1.14.13.2)" in subsystem p-Hydroxybenzoate degradation (EC 1.14.13.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YFX2 at UniProt or InterPro

Protein Sequence (389 amino acids)

>RR42_RS21940 4-hydroxybenzoate 3-monooxygenase (EC 1.14.13.2) (Cupriavidus basilensis FW507-4G11)
MRTQVAIIGAGPAGLLLGQLLAKAGIDAVIVEQRSPDYILGRIRAGILESVTADALERAG
VAQRLQHDGLVHHGIELSYGGERHRIDFHALIGRSVTVYGQTEVTRDLMAARQAGNAVTI
YDAQDVSVHDFDTATPMVRYRKGGQQYELRCDFIAGCDGFHGVTRRSVPEPSRRIFERVY
PFGWLGVLADTPPVANELIYASHERGFALCSMRSLTRSRYYVQVSADERVEDWSDQRFWD
ELRSRLDTSAAEALVTGASIEKSIAPLRSFVCEPMRFGNLFLAGDAAHIVPPTGAKGLNL
AASDVLYLADGLIARYLRDDASELDAYSQKCLRRVWKAERFSWWMTSLLHRFPDADDFAL
RIQQAELDYLAGSRAAQMSLAENYVGLPY