Protein Info for RR42_RS21935 in Cupriavidus basilensis FW507-4G11

Annotation: 4-hydroxybenzoate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 446 transmembrane" amino acids 17 to 41 (25 residues), see Phobius details amino acids 55 to 76 (22 residues), see Phobius details amino acids 84 to 104 (21 residues), see Phobius details amino acids 111 to 130 (20 residues), see Phobius details amino acids 142 to 166 (25 residues), see Phobius details amino acids 172 to 193 (22 residues), see Phobius details amino acids 254 to 274 (21 residues), see Phobius details amino acids 289 to 309 (21 residues), see Phobius details amino acids 316 to 334 (19 residues), see Phobius details amino acids 340 to 357 (18 residues), see Phobius details amino acids 378 to 400 (23 residues), see Phobius details amino acids 408 to 427 (20 residues), see Phobius details TIGR00895: MFS transporter, aromatic acid:H+ symporter (AAHS) family" amino acids 2 to 399 (398 residues), 427.7 bits, see alignment E=2.2e-132 PF07690: MFS_1" amino acids 24 to 393 (370 residues), 158.4 bits, see alignment E=3.7e-50 PF00083: Sugar_tr" amino acids 28 to 269 (242 residues), 85.5 bits, see alignment E=5.7e-28 PF06779: MFS_4" amino acids 40 to 195 (156 residues), 35 bits, see alignment E=1.6e-12

Best Hits

Swiss-Prot: 57% identical to PCAK_PSEPU: 4-hydroxybenzoate transporter PcaK (pcaK) from Pseudomonas putida

KEGG orthology group: K08195, MFS transporter, AAHS family, 4-hydroxybenzoate transporter (inferred from 64% identity to reh:H16_B2293)

Predicted SEED Role

"4-hydroxybenzoate transporter" in subsystem Cinnamic Acid Degradation or Gentisare degradation or Phenylpropanoid compound degradation or Salicylate and gentisate catabolism or p-Hydroxybenzoate degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y8R4 at UniProt or InterPro

Protein Sequence (446 amino acids)

>RR42_RS21935 4-hydroxybenzoate transporter (Cupriavidus basilensis FW507-4G11)
MDVQQFIDSQPFSRFQWIILILCFLIVAADGFDTAAIGFIAPMLAKEWGVSRAHLGPVMS
AALFGLAAGALVAGPLADRFGRKGVLVGSVLCFGGWSVASAFASSLEALTVLRFLTGLGL
GAAMPNAVTLMSEYAPTRRRSLAVNAMFCGFTLGSSAGGFAAAWLIPHYGWHSVLLVGGV
APLLLAVLLILFLPESVRFLVARKAPDARIAAALSKVHPGVLRADERFHVQEAAPTGASS
LRTILMPQFRSGTVLLWTTYFMGLLIFYLLTSWLPTLFADAGYPIEKAALITALFPLGGG
IGTLTVGWLMDRGHPWRIVAGTYALTGALVYAVGHGAGDVFLLGVLVFAAGTCMNGAQSS
MPTLAAGFYPTQCRATGVAWMLGIGRFGGIAGALLGAQILGLGWSFGKIFGLLSLPAFVA
TAALLIASARPRAAVRPAVGQHDAAH