Protein Info for RR42_RS21775 in Cupriavidus basilensis FW507-4G11

Annotation: branched-chain alpha-keto acid dehydrogenase subunit E2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00364: Biotin_lipoyl
  • amino acids 5 to 75 (71 residues), 52.7 bits, E=4.6e-18
• TIGR01349: pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  • amino acids 5 to 410 (406 residues), 471.2 bits, E=2e-145
• PF02817: E3_binding
  • amino acids 124 to 159 (36 residues), 60 bits, 3e-20
• PF00198: 2-oxoacid_dh
  • amino acids 187 to 409 (223 residues), 282.2 bits, E=4.7e-88

Best Hits

KEGG orthology group: K00627, pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC: 2.3.1.12] (inferred from 53% identity to rru:Rru_A1879)

Predicted SEED Role

"Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex (EC 2.3.1.12)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate (EC 2.3.1.12)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (23/26 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (19/22 steps found)
• pyruvate fermentation to acetate and (S)-lactate I (4/4 steps found)
• pyruvate decarboxylation to acetyl CoA I (3/3 steps found)
• pyruvate fermentation to acetate II (3/3 steps found)
• pyruvate fermentation to acetate V (2/3 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (12/17 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (18/27 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (17/26 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (5/10 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Glycolysis / Gluconeogenesis
• Pyruvate metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.12

Use Curated BLAST to search for 2.3.1.12

Sequence Analysis Tools

See A0A0C4YMH1 at UniProt or InterPro

Protein Sequence (410 amino acids)

>RR42_RS21775 branched-chain alpha-keto acid dehydrogenase subunit E2 (Cupriavidus basilensis FW507-4G11)
MATLLRMPEVAANATQATLQAWTKNEGDTIAVGECIAEIETDKAVVELNADSAGVLARRL
VAAGQDVEVGAPIGVLLVNGETSADIDALIAAAGGGAQVPPAKAESAGQAMVAAKAASAQ
ATRIFASPLARRLAAQRGLDLAALRGSGPNGRIVKRDIEQAATAAAAASAPAVARPAAPQ
AKASDAFTEIPHSNMRRTIARRLSESKATIPHFYLTADCRMEPLLALRAQINANAPRKIS
VNDFIVRAVAVALREVPAANVGWTDTAMRQYPQADIAVAVATDAGLITPIVRAADTKPLS
VISAEIADLATRARASQLRPEEYQGGSFSVSNLGMFGVSEFSAIINPPQAAILAVGATQA
VPVVEGGALKAGQVMRCTLSVDHRAIDGALAAQWLAAFKRLLENPLSMLI