Protein Info for RR42_RS21335 in Cupriavidus basilensis FW507-4G11

Annotation: FAD-linked oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 476 PF01565: FAD_binding_4" amino acids 50 to 187 (138 residues), 132.9 bits, see alignment E=6.8e-43 PF02913: FAD-oxidase_C" amino acids 226 to 472 (247 residues), 151.6 bits, see alignment E=3.3e-48

Best Hits

KEGG orthology group: None (inferred from 81% identity to cti:RALTA_A1415)

Predicted SEED Role

"D-2-hydroxyglutarate dehydrogenase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y8H2 at UniProt or InterPro

Protein Sequence (476 amino acids)

>RR42_RS21335 FAD-linked oxidase (Cupriavidus basilensis FW507-4G11)
MASPAPQPAPSSALLRELATLLDAPGLQTGDAIETRFRKDWYAPLGAVPPLAVVRARNTQ
DVAAVLALCHRLRQPVVPQGGLTGLAGAATPEGGELVLSLERMRGVEEIDAQAGTMTVMA
GTTLQAAQEAARAAGWLLAVDLGARGSCQIGGNIATNAGGNRVIRYGMMRDQVLGLEAVL
ADGTVVSSLNKMQKNNAGYDVRQLFIGSEGTLGVITRAVLRLAPLPSATQTALCALATYD
DVVRLLRHAQRKLSGRLSAFEVMWADFYGLVTTRVPGVRAPLPAGHPFYVLLDLQGNDAS
QDAPVFESMLESAMEAGLIQDAAVASSHKEAQSFWQLRDAVAEFPVMWSPNAAYDVSLPI
GRIGEFAETLRTRLLAVWPHAEPVNFGHVGDSNLHVSVYLPGATDLDFPEHEISDVMYGV
VREFKGSVSAEHGIGFHKKPYLHCSRTPQELGLMRLIKRALDPHNILSPGRVFDLD