Protein Info for RR42_RS21300 in Cupriavidus basilensis FW507-4G11

Annotation: GntR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 PF00392: GntR" amino acids 12 to 73 (62 residues), 68.8 bits, see alignment E=2.6e-23 PF07729: FCD" amino acids 98 to 226 (129 residues), 76.9 bits, see alignment E=1.9e-25

Best Hits

KEGG orthology group: K05799, GntR family transcriptional regulator, transcriptional repressor for pyruvate dehydrogenase complex (inferred from 82% identity to cti:RALTA_B0086)

Predicted SEED Role

"Glycolate utilization operon transcriptional activator GlcC" in subsystem Glycolate, glyoxylate interconversions

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YG68 at UniProt or InterPro

Protein Sequence (241 amino acids)

>RR42_RS21300 GntR family transcriptional regulator (Cupriavidus basilensis FW507-4G11)
MAAGRQARGRVEEVMRKLETAMLDGTWPAGARLPAERLLAEQYGVARNTIREATQRLAAR
GLLQSRQGAGVFVTEQLRTGFASPWRQLVADHPVLRDDILEFRRVLEGATAYFAALRADA
GDLKRIRGLLRALEAARQQDDKAAEAEADAKLHEAIAQASHNTMFLHLHTSVIGMLREHI
TINGTGLRVQDEDASALLLLQHRTLCEAICARRPEEARTAMQTHIDFVRSRVEPQGDGAS
A