Protein Info for RR42_RS21290 in Cupriavidus basilensis FW507-4G11

Updated annotation (from data): L-lactate dehydrogenase, LutC subunit
Rationale: Specifically important for utilization of L-lactate or D,L-lactate. (Also important on various nitrogen sources with lactate as the carbon source.) This is related to the LutABC system from Bacillus subtilis (PMC3347220, PMC2668416).
Original annotation: lactate utilization protein C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 PF02589: LUD_dom" amino acids 108 to 224 (117 residues), 98.1 bits, see alignment E=2.9e-32

Best Hits

KEGG orthology group: K00782, hypothetical protein (inferred from 74% identity to bam:Bamb_2804)

Predicted SEED Role

"Predicted L-lactate dehydrogenase, hypothetical protein subunit YkgG" in subsystem Lactate utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YFN9 at UniProt or InterPro

Protein Sequence (234 amino acids)

>RR42_RS21290 L-lactate dehydrogenase, LutC subunit (Cupriavidus basilensis FW507-4G11)
MSTLSARERMLGRLRAAAPATTADASQLDARIDAHYDARREAATPAELAQAMQAALGASH
ALAWCASAEAWPAQLAGKLAAAGVRRLLLDPAAEQGAALMRALPASVAPLSYARPIEAWK
AELFDTVDAGFTVARSGIAATGTLVLAPDAQTPRTVSLVPPLHIALVYAETLHPDLHCAA
RAERWSAGMPTNLVLVSGPSKTSDIQQTLAYGAHGPRELWVIIVTGSAGTGAAQ