Protein Info for RR42_RS21290 in Cupriavidus basilensis FW507-4G11
Updated annotation (from data): L-lactate dehydrogenase, LutC subunit
Rationale: Specifically important for utilization of L-lactate or D,L-lactate. (Also important on various nitrogen sources with lactate as the carbon source.) This is related to the LutABC system from Bacillus subtilis (PMC3347220, PMC2668416).
Original annotation: lactate utilization protein C
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K00782, hypothetical protein (inferred from 74% identity to bam:Bamb_2804)Predicted SEED Role
"Predicted L-lactate dehydrogenase, hypothetical protein subunit YkgG" in subsystem Lactate utilization
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A0C4YFN9 at UniProt or InterPro
Protein Sequence (234 amino acids)
>RR42_RS21290 L-lactate dehydrogenase, LutC subunit (Cupriavidus basilensis FW507-4G11) MSTLSARERMLGRLRAAAPATTADASQLDARIDAHYDARREAATPAELAQAMQAALGASH ALAWCASAEAWPAQLAGKLAAAGVRRLLLDPAAEQGAALMRALPASVAPLSYARPIEAWK AELFDTVDAGFTVARSGIAATGTLVLAPDAQTPRTVSLVPPLHIALVYAETLHPDLHCAA RAERWSAGMPTNLVLVSGPSKTSDIQQTLAYGAHGPRELWVIIVTGSAGTGAAQ