Protein Info for RR42_RS21285 in Cupriavidus basilensis FW507-4G11

Updated annotation (from data): L-lactate dehydrogenase, LutB subunit
Rationale: Specifically important for utilization of L-lactate or D,L-lactate. (Also important on various nitrogen sources with lactate as the carbon source.) This is related to the LutABC system from Bacillus subtilis (PMC3347220, PMC2668416).
Original annotation: (Fe-S)-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 476 TIGR00273: iron-sulfur cluster-binding protein" amino acids 17 to 391 (375 residues), 474.9 bits, see alignment E=1.2e-146 PF02589: LUD_dom" amino acids 71 to 294 (224 residues), 165.2 bits, see alignment E=4.6e-52 PF13183: Fer4_8" amino acids 311 to 377 (67 residues), 48.2 bits, see alignment E=3.8e-16 PF13534: Fer4_17" amino acids 312 to 377 (66 residues), 26.7 bits, see alignment E=2e-09 PF11870: LutB_C" amino acids 385 to 474 (90 residues), 93.3 bits, see alignment E=3e-30

Best Hits

KEGG orthology group: None (inferred from 88% identity to reu:Reut_B5446)

Predicted SEED Role

"Predicted L-lactate dehydrogenase, Iron-sulfur cluster-binding subunit YkgF" in subsystem L-rhamnose utilization or Lactate utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y8G6 at UniProt or InterPro

Protein Sequence (476 amino acids)

>RR42_RS21285 L-lactate dehydrogenase, LutB subunit (Cupriavidus basilensis FW507-4G11)
MHFVPAADFKARSRAALDDPKLRSSFRGAMDFLQAKRAVQFPDGDELEQLRDLGEAIRQH
ALSQLPDLLVQLEDKLTAAGVQVHWAETADEANAIVHGIAQARQASRVIKGKSMASEEIE
LNHYLAERGIDCIESDMGEYIVQLAGEKPSHIVMPAIHKTRGDIAELFEQHIPGTPYTED
VDELIQTGRRALRQEFVNADIGLSGVNFAAADTGTLWLVENEGNGRLSTTVPDVHIAIMG
MEKVVARLEHIVPLASLLTRSATGQAITTYFNLISGPRRAGERDGPREVHLVLLDNGRSQ
AYADEQLRATLQCIRCGACMNHCPVYTRIGGHAYGTTYPGPIGKIISPHLLGLDATADLA
TASSLCGACGEVCPVRIPIPQLLIRLRTEANRDPSEQVAHPLRGQGTKFSRGEHLVWRFW
SGAFAHPLAYRLFRWAATRLRVLTPKHQLGWTRHRAPLTPAPRSLSDLLRERGQAE