Protein Info for RR42_RS20805 in Cupriavidus basilensis FW507-4G11

Annotation: tRNA modification GTPase TrmE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 484 PF10396: TrmE_N" amino acids 17 to 133 (117 residues), 136.1 bits, see alignment E=1.4e-43 TIGR00450: tRNA modification GTPase TrmE" amino acids 21 to 484 (464 residues), 332.3 bits, see alignment E=5.5e-103 PF12631: MnmE_helical" amino acids 136 to 481 (346 residues), 195.4 bits, see alignment E=2.7e-61 TIGR00231: small GTP-binding protein domain" amino acids 231 to 396 (166 residues), 73 bits, see alignment E=2.5e-24 PF02421: FeoB_N" amino acids 231 to 321 (91 residues), 37.4 bits, see alignment E=3.8e-13 PF01926: MMR_HSR1" amino acids 232 to 354 (123 residues), 92.9 bits, see alignment E=2.9e-30

Best Hits

Swiss-Prot: 85% identical to MNME_CUPMC: tRNA modification GTPase MnmE (mnmE) from Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)

KEGG orthology group: K03650, tRNA modification GTPase (inferred from 85% identity to rme:Rmet_3610)

Predicted SEED Role

"GTPase and tRNA-U34 5-formylation enzyme TrmE" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YI98 at UniProt or InterPro

Protein Sequence (484 amino acids)

>RR42_RS20805 tRNA modification GTPase TrmE (Cupriavidus basilensis FW507-4G11)
MTATHSLQPRSARTTPIAAIATAPGRGGIGVVRVSGPDVSAIAQAVCGQALKARHATYLP
FLDAHGKAIDHGLALYFPAPHSYTGEEVLELQGHGGPVVMQMLLARCLDAGREMGLRLAE
PGEFTRRAFLNDKLDLAQAEAVADLIEASTEAAARSAARSMEGVFSDAIRALVEQVIHLR
MLVEATLDFPEEEIDFLEASNARGQLANIRDALGGVLAQAKQGSLLREGLSVVLAGQPNV
GKSSLLNALAGAELAIVTPIPGTTRDRVRETIQIEGIPLHIIDTAGLREDATDEVERIGI
ERTWQAVGRADLVLHLVDAADYVEHGLSEIDDAIDDRLCGHLPPGSPILRVVNKIDLAPK
VGEHHFGADRPHVVAAIGPNPAEVWISARTGAGIDLLRGQLLRLVGWQSGNEGTFLARER
HLTALRNAQSHLDLAEERAAQEAQALDLFAEELRLAQDHLNSITGEFSSDDLLGTIFTRF
CIGK