Protein Info for RR42_RS20785 in Cupriavidus basilensis FW507-4G11

Annotation: acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 391 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 41 to 64 (24 residues), see Phobius details amino acids 85 to 107 (23 residues), see Phobius details amino acids 143 to 168 (26 residues), see Phobius details amino acids 175 to 194 (20 residues), see Phobius details amino acids 200 to 220 (21 residues), see Phobius details amino acids 232 to 253 (22 residues), see Phobius details amino acids 260 to 281 (22 residues), see Phobius details amino acids 293 to 312 (20 residues), see Phobius details amino acids 323 to 344 (22 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 7 to 339 (333 residues), 81 bits, see alignment E=4.5e-27

Best Hits

KEGG orthology group: None (inferred from 53% identity to bch:Bcen2424_4116)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YFR8 at UniProt or InterPro

Protein Sequence (391 amino acids)

>RR42_RS20785 acyltransferase (Cupriavidus basilensis FW507-4G11)
MSRRVLELTGLRSVAVMLVVISHAEHMAKGGYTGLLAPLRYFANGGVGVFISFVLSGFLI
TELLQAEWRACGSIKLMRFYGRRALRIWPAFYVYLIALGLFGIVGLIDVDARQLLFAAAH
LWNYSEMLGLGNVNMVHPAGAWLLGHFWTLALDEQFYWLWPPVLLLLLRGRNPRWLVLVI
MLMPLVRVLCYFTTPSLRGQLGLMLHTGVDPVLMGCYIALDRERLKAQLNARFAGAFALP
ALILALLLGLPVIGTLAGGIWTATYGPVALAAAAGLLILAVVERPELWISRLLRSKAFVF
VGTISFSLYVWQQLFTSTASPLALRFPFCILETLAAAALSYLLVEAPFLRLRSWLGRRAR
ATALEAVSEEGGAPAHSVEAEPLQDLPQQAL