Protein Info for RR42_RS20645 in Cupriavidus basilensis FW507-4G11

Annotation: MexE family multidrug efflux RND transporter periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 410 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF00529: CusB_dom_1" amino acids 36 to 358 (323 residues), 48.1 bits, see alignment E=1.8e-16 TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 38 to 371 (334 residues), 272.9 bits, see alignment E=1.5e-85 PF16576: HlyD_D23" amino acids 62 to 291 (230 residues), 35.9 bits, see alignment E=9.8e-13 PF13533: Biotin_lipoyl_2" amino acids 63 to 111 (49 residues), 39.6 bits, see alignment 6.9e-14 PF13437: HlyD_3" amino acids 174 to 287 (114 residues), 29.3 bits, see alignment E=2.4e-10

Best Hits

Swiss-Prot: 48% identical to ACRA_ECO57: Multidrug efflux pump subunit AcrA (acrA) from Escherichia coli O157:H7

KEGG orthology group: K03585, membrane fusion protein (inferred from 83% identity to reu:Reut_A3440)

MetaCyc: 48% identical to multidrug efflux pump membrane fusion lipoprotein AcrA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-1551; TRANS-RXN-1552; TRANS-RXN-354; TRANS-RXN-355; TRANS-RXN-356; TRANS-RXN-357; TRANS-RXN-359; TRANS-RXN-360; TRANS-RXN0-592

Predicted SEED Role

"RND efflux system, membrane fusion protein CmeA" in subsystem Multidrug Resistance Efflux Pumps or Multidrug efflux pump in Campylobacter jejuni (CmeABC operon)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YLT0 at UniProt or InterPro

Protein Sequence (410 amino acids)

>RR42_RS20645 MexE family multidrug efflux RND transporter periplasmic adaptor subunit (Cupriavidus basilensis FW507-4G11)
MRKSQRITCVAAAVLSALALSACGEKKPQGGAMPPPEVGVVTVTPTTVSVINELPGRLEG
VRTAEVRARVSGIVLSRNYTEGGEVKAGQLLFKIDPAPYQAQLESAKASLARAEANAVAA
RQKAERYKPLVAVNAVSKQEYDEAVAAAGQATADIASAKAAVSTAQINLGYTAVTAPISG
RVGRALVTEGALVGSGEATKLTTVEQVDPIRVTFTQPASEVMKLRRAIESGKVKGVDGGA
RVHLFIEDGREYEQTGKLLFSDMTVDPTTGAITLRAQFPNAKRELLSGTFVRVKIEQGVD
ENALTVPQRALIRNAQGASVMVVGSDGNVAAVPVKAPQAIGESWIVTEGLKGGEKVIVEG
LQKVKVGAPAKAVPFVSKTAAASAPDAQPVASGASAPAAVAADKADAKQG