Protein Info for RR42_RS20440 in Cupriavidus basilensis FW507-4G11

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 822 transmembrane" amino acids 15 to 38 (24 residues), see Phobius details amino acids 51 to 76 (26 residues), see Phobius details amino acids 88 to 110 (23 residues), see Phobius details amino acids 357 to 381 (25 residues), see Phobius details PF00672: HAMP" amino acids 379 to 430 (52 residues), 40.3 bits, see alignment 6.6e-14 PF00512: HisKA" amino acids 582 to 648 (67 residues), 38.9 bits, see alignment E=1.5e-13 PF02518: HATPase_c" amino acids 696 to 806 (111 residues), 67.7 bits, see alignment E=2.4e-22

Best Hits

KEGG orthology group: None (inferred from 86% identity to reu:Reut_A3403)

Predicted SEED Role

"Nitrogen regulation protein NtrY (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YFH6 at UniProt or InterPro

Protein Sequence (822 amino acids)

>RR42_RS20440 histidine kinase (Cupriavidus basilensis FW507-4G11)
MSAPPSLWDSRFRRVLYRVVAGIIVFLALVLVALLAGASANTEFFDRYFTLLFKINLVIG
ILLVLIIGALALTLWLRYRRGKFGTRLMTKLAVFFGVVGVLPGVLIYLVSLQFVSRSIES
WFDVRVETALEAGLNLGRSTIDSALSDLQGKARLMADQLTGSPNVATSLQLNRLREQYGV
QEAAIFTGSGRVIATASSNYASLVPDLPSGVLAEQARLAGGYAAVEGGADPSVDSHHQPE
RTDGAHLYRLRVIVPLGPAPTAQTDTSSASDSASRPAGKPALNAASRWAGSGLSVERRPE
DAASSGFGLVGDTVREERYLQVVHPVPAALARNADEVQRAYQEYQEKALGRTGLRKMYIG
TLTLTLFLAVFIAVMLALLLGGQLARPLLMLLQGTKEVAEGDLSPKRELKSRDELGMLTQ
QFNMMTRQLSEARIAVEQNRSALEKSTAYLESVLQNLTAGVFVFDRRFVLITANPGAERI
FRQPFAGELGQPIDSIPALGEFGDIVRQAFSEQSTSEMLGGAQHWQKQIELPQSDEEQAL
TLLVRGARLPGGHGDERDEPGYVVVFDDISDVISAQRSVAWGEVARRLAHEIKNPLTPIQ
LSAERLQMKLSPKLEGADVDVLKRGATTIVNQVQAMKRMVDDFRDYARTPPALLQSLQLN
GLVAEVLHLYGIDDTGTHEHAVIHPSLAASLPEIKGDPTQLRQVIHNLLQNAQDAVADNL
GAARAAPHIALHTETVEYKDSAGEDRQAVKLTIADNGPGFAPRILSRAFEPYVTTKAKGT
GLGLAMVKKIIDEHGARIELRNRMEGSDIIGAQISILFVKLA