Protein Info for RR42_RS20370 in Cupriavidus basilensis FW507-4G11

Annotation: pterin-4-alpha-carbinolamine dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01329: Pterin_4a
  • amino acids 8 to 97 (90 residues), 116.9 bits, E=1.9e-38

Best Hits

Swiss-Prot: 76% identical to PHS2_CUPNJ: Putative pterin-4-alpha-carbinolamine dehydratase 2 (Reut_A3388) from Cupriavidus necator (strain JMP 134 / LMG 1197)

KEGG orthology group: K01724, 4a-hydroxytetrahydrobiopterin dehydratase [EC: 4.2.1.96] (inferred from 76% identity to reu:Reut_A3388)

MetaCyc: 59% identical to Pterin-4-alpha-carbinolamine dehydratase (Homo sapiens)
4a-hydroxytetrahydrobiopterin dehydratase. [EC: 4.2.1.96]

Predicted SEED Role

"Pterin-4-alpha-carbinolamine dehydratase (EC 4.2.1.96)" in subsystem Pterin biosynthesis (EC 4.2.1.96)

MetaCyc Pathways

• L-phenylalanine degradation V (2/3 steps found)
• tetrahydropteridine recycling (1/2 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.96

Sequence Analysis Tools

See A0A0C4Y7U1 at UniProt or InterPro

Protein Sequence (105 amino acids)

>RR42_RS20370 pterin-4-alpha-carbinolamine dehydratase (Cupriavidus basilensis FW507-4G11)
MSPAPVVPLTLEERAPLLASLSGWSTVDDRDAIHKRFTFADFNAAFAFMTRVALAAEKAD
HHPEWFNVYNRVEVTLSTHDANGLTRRDTDLAAFMDRAAASLAKA