Protein Info for RR42_RS20350 in Cupriavidus basilensis FW507-4G11

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 233 transmembrane" amino acids 15 to 35 (21 residues), see Phobius details amino acids 47 to 64 (18 residues), see Phobius details amino acids 76 to 95 (20 residues), see Phobius details amino acids 101 to 120 (20 residues), see Phobius details amino acids 130 to 148 (19 residues), see Phobius details amino acids 154 to 174 (21 residues), see Phobius details amino acids 181 to 202 (22 residues), see Phobius details amino acids 208 to 229 (22 residues), see Phobius details PF07947: YhhN" amino acids 50 to 227 (178 residues), 156.4 bits, see alignment E=3.2e-50

Best Hits

Swiss-Prot: 48% identical to Y1401_MYCTO: Uncharacterized membrane protein MT1445 (MT1445) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: None (inferred from 72% identity to reh:H16_A3675)

Predicted SEED Role

"POSSIBLE MEMBRANE PROTEIN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YF51 at UniProt or InterPro

Protein Sequence (233 amino acids)

>RR42_RS20350 hypothetical protein (Cupriavidus basilensis FW507-4G11)
MSWLAMMMPARVREWWLAGTMAGLVYGGLLVTVAMDSPPGAPLNGQIAFQPLWKTAMALL
LVRAARFHPLRRERRWLMAALLFCAVGDFLLAMPWLSFSFIGGLGAFLIAHFAYLGLFVP
MAGDWRAHRLIACGVVVGAAGVMLARFWPNLGALAVPVSVYVGALAAMACAALLAKLPTP
LAAIGALCFAVSDGLLGTARFLAPFDTFALGIWWTYAAAQVLLVAGVAAGRDK