Protein Info for RR42_RS20080 in Cupriavidus basilensis FW507-4G11

Updated annotation (from data): L-serine ammonia-lyase (EC 4.3.1.17)
Rationale: Specifically important for utilizing L-Serine. Automated validation from mutant phenotype: the predicted function (4.3.1.17) was linked to the condition via a SEED subsystem. This annotation was also checked manually.
Original annotation: serine dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00720: L-serine ammonia-lyase
  • amino acids 3 to 455 (453 residues), 696.2 bits, E=1e-213
• PF03315: SDH_beta
  • amino acids 4 to 156 (153 residues), 200 bits, E=2.9e-63
• PF03313: SDH_alpha
  • amino acids 188 to 452 (265 residues), 302.8 bits, E=2.5e-94

Best Hits

Swiss-Prot: 64% identical to SDHL_STRCO: L-serine dehydratase (sdaA) from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)

KEGG orthology group: K01752, L-serine dehydratase [EC: 4.3.1.17] (inferred from 89% identity to reh:H16_A3622)

Predicted SEED Role

"L-serine dehydratase (EC 4.3.1.17)" in subsystem Glycine and Serine Utilization or Pyruvate Alanine Serine Interconversions (EC 4.3.1.17)

MetaCyc Pathways

• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• D-serine degradation (3/3 steps found)
• L-serine degradation (3/3 steps found)
• glycine degradation (3/3 steps found)
• L-methionine biosynthesis II (5/6 steps found)
• L-cysteine degradation II (2/3 steps found)
• L-tryptophan degradation II (via pyruvate) (2/3 steps found)
• glycine betaine degradation I (5/8 steps found)
• glycine betaine degradation III (4/7 steps found)
• purine nucleobases degradation II (anaerobic) (16/24 steps found)
• felinine and 3-methyl-3-sulfanylbutan-1-ol biosynthesis (2/5 steps found)
• L-mimosine degradation (4/8 steps found)
• glutathione-mediated detoxification I (3/8 steps found)

KEGG Metabolic Maps

• Cysteine metabolism
• Glycine, serine and threonine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.3.1.17

Sequence Analysis Tools

See A0A0C4YLC3 at UniProt or InterPro

Protein Sequence (458 amino acids)

>RR42_RS20080 L-serine ammonia-lyase (EC 4.3.1.17) (Cupriavidus basilensis FW507-4G11)
MAVSVFDLFKVGIGPSSSHTVGPMRAALMFAQGLARDGLLPQVASVRVELYGSLGATGRG
HGTDKGVILGLLGEAPDTIDPDTIDVRLAALRASRTLSLLGTHPVPFVEKEHIVFYRREA
MAEHPNGMKFHAFNAGGERIREGRYLSVGGGFIITAGAANTHILEADQQLPHPFRSGRAM
LEMAAASKKSIARLMMENECVWRSEAEVNAGLLQIWAVMQACVARGCRTDGELPGPFKVK
RRAHDLFRNLTEHAERALADPLSVIDWVNLYAIAVNEENAAGGRVVTAPTNGAAGIIPAV
LHYYDRFVPGANPQGVIDFLLTAGAIGMLYKLNASISGAEVGCQGEVGVACSMAAGALAA
VMGGTPEQVENAAEIGMEHNLGLTCDPVGGLVQIPCIERNAMASVKAVNAARMALRGDGM
HYVSLDSVIKTMRETGADMKTKYKETARGGLAVNIVEC