Protein Info for RR42_RS19980 in Cupriavidus basilensis FW507-4G11

Annotation: nitrate ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF13379: NMT1_2" amino acids 51 to 266 (216 residues), 41.4 bits, see alignment E=2.3e-14 PF09084: NMT1" amino acids 51 to 262 (212 residues), 81.7 bits, see alignment E=1.1e-26 PF12974: Phosphonate-bd" amino acids 113 to 205 (93 residues), 27.6 bits, see alignment E=3e-10

Best Hits

KEGG orthology group: K02051, sulfonate/nitrate/taurine transport system substrate-binding protein (inferred from 77% identity to bge:BC1002_4730)

Predicted SEED Role

"ABC-type nitrate/sulfonate/bicarbonate transport systems, periplasmic components" in subsystem Alkanesulfonate assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y7K7 at UniProt or InterPro

Protein Sequence (338 amino acids)

>RR42_RS19980 nitrate ABC transporter substrate-binding protein (Cupriavidus basilensis FW507-4G11)
MNAYRKGMLAVASAALAALAAAHTAHAADAKLSIMVGGATKIIYLPARLTEQLGYFKEEG
LDVEILSQPAGVDAENELLAGAVQGVVGFYDHTIDLQSKGKEVEAVVVFGKVPGEVEMVA
TRAAGQIKSMADVKGKTLGVTGLGSSTNFLTQYLAFKAGVAPSQYTVLPVGADNSFMAAI
RQSRIDAGMTTEPTISQLLKTGEAQVLVDMRTAEGTTQALGGLYPASSLYMQRAWVEGHK
DQVQKLARAFVKTMRFIKAHSAEEIAQKMPKDYYGNNRELYVKALGASLPMFTDDGRMPA
GGPETVLKVLSSFDPTVKGKHIELGRTFTNEFVDHVAR