Protein Info for RR42_RS19895 in Cupriavidus basilensis FW507-4G11

Annotation: elongation factor GreAB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 139 PF01272: GreA_GreB" amino acids 53 to 127 (75 residues), 64.9 bits, see alignment E=2.6e-22

Best Hits

Swiss-Prot: 37% identical to RNK_SHIFL: Regulator of nucleoside diphosphate kinase (rnk) from Shigella flexneri

KEGG orthology group: K06140, regulator of nucleoside diphosphate kinase (inferred from 73% identity to reu:Reut_A3298)

Predicted SEED Role

"Regulator of nucleoside diphosphate kinase" in subsystem Transcription factors bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YEW8 at UniProt or InterPro

Protein Sequence (139 amino acids)

>RR42_RS19895 elongation factor GreAB (Cupriavidus basilensis FW507-4G11)
MTASSKQQPTLYLTELDVTRLERIAGRAGAAPLAEMLDSILERAAIVPAEAIPKDVVTMN
SSLLCALEGEATPRRWTLVYPDTADFEEGRLSVLSPIGRVLLGARAGQTVSYRLPDGREQ
SVTVVELSFQPEANGQYTV