Protein Info for RR42_RS19785 in Cupriavidus basilensis FW507-4G11

Annotation: allantoate amidohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 421 TIGR01879: amidase, hydantoinase/carbamoylase family" amino acids 30 to 408 (379 residues), 366.3 bits, see alignment E=1e-113 PF04389: Peptidase_M28" amino acids 66 to 148 (83 residues), 24.9 bits, see alignment E=2.3e-09 PF01546: Peptidase_M20" amino acids 83 to 411 (329 residues), 70.6 bits, see alignment E=2.6e-23 PF07687: M20_dimer" amino acids 215 to 319 (105 residues), 22 bits, see alignment E=1.9e-08

Best Hits

Swiss-Prot: 40% identical to AMAB1_GEOSE: N-carbamoyl-L-amino acid hydrolase (amaB) from Geobacillus stearothermophilus

KEGG orthology group: K06016, N-carbamoyl-L-amino-acid hydrolase [EC: 3.5.1.87] (inferred from 90% identity to cti:RALTA_A3043)

Predicted SEED Role

"N-carbamoyl-L-amino acid hydrolase (EC 3.5.1.87)" in subsystem Hydantoin metabolism (EC 3.5.1.87)

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.87

Use Curated BLAST to search for 3.5.1.87

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YHH1 at UniProt or InterPro

Protein Sequence (421 amino acids)

>RR42_RS19785 allantoate amidohydrolase (Cupriavidus basilensis FW507-4G11)
MAATLTPATETGARIMAWADTLAVHTEQPGMLTRTYLTEAHHGAAAQLTEWMQAAGMTVR
RDAAGNVIGRYEGTTPNVPALLTGSHFDTVRDGGRYDGNLGVILPVACVAQWNRQGKRFP
FAIEVVGFAEEEGVRFKATLLGSRAIAGTFDTNVLDNVDDSGKTMREVMRAAGFDPAGLP
AAAHAREQVLAFVEVHIEQGPVLLNEGLSLGVVTAISGATRFIVELEGLAGHAGTVPMDM
RRDAAMAGAEIGLFIERRCSGLPGLVGTIGQFNVPNGAANVVPGRAVFSIDIRAGEDAVR
QAAVNDVLAEIERVCARRNVRVQIRKTHEAVSVPCAPWLQQQWADAIARQGLPVRHLPSG
AGHDAMAIAAIADVAMLFVRCGNGGISHHPTEIMTAEDAASAAAVFSDFVEHFDKHSARQ
Q