Protein Info for RR42_RS19775 in Cupriavidus basilensis FW507-4G11

Annotation: GCN5 family acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 211 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF13420: Acetyltransf_4" amino acids 33 to 190 (158 residues), 41.3 bits, see alignment E=3.4e-14 PF00583: Acetyltransf_1" amino acids 64 to 170 (107 residues), 47 bits, see alignment E=5.8e-16 PF13673: Acetyltransf_10" amino acids 75 to 178 (104 residues), 29 bits, see alignment E=1.9e-10 PF13508: Acetyltransf_7" amino acids 83 to 171 (89 residues), 35.5 bits, see alignment E=2.2e-12

Best Hits

Swiss-Prot: 55% identical to PAT_ALCFA: Phosphinothricin N-acetyltransferase (pat) from Alcaligenes faecalis

KEGG orthology group: K03823, phosphinothricin acetyltransferase [EC: 2.3.1.183] (inferred from 79% identity to cti:RALTA_A3039)

Predicted SEED Role

"GCN5-related N-acetyltransferase"

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.183

Use Curated BLAST to search for 2.3.1.183

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y7G8 at UniProt or InterPro

Protein Sequence (211 amino acids)

>RR42_RS19775 GCN5 family acetyltransferase (Cupriavidus basilensis FW507-4G11)
MKAPLATLSAACATPMAVANATAAVQACASPSIRDATAADIPAIQAIYAHHVRHGRASFE
EVEPGVDDIRLRHAEVRRQGLPYLVAERGGEVLGYAYASAYRTRSAYRFAIEDSVYIDER
YRGQGLGLALLAALVSRCESGPWRQMVAVVACTASGEGAGSLALHERVGFRTIGRLQSVG
FKHGQWIDTVLMQRPLGDGDETPPVERAAKP