Protein Info for RR42_RS19665 in Cupriavidus basilensis FW507-4G11

Annotation: alkyl hydroperoxide reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 165 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF08534: Redoxin" amino acids 30 to 153 (124 residues), 64.9 bits, see alignment E=1.1e-21 PF00578: AhpC-TSA" amino acids 36 to 142 (107 residues), 49.7 bits, see alignment E=5.3e-17 PF13905: Thioredoxin_8" amino acids 49 to 140 (92 residues), 31.5 bits, see alignment E=2.9e-11

Best Hits

KEGG orthology group: None (inferred from 72% identity to reu:Reut_A3250)

Predicted SEED Role

"Thiol:disulfide interchange protein, thioredoxin family" in subsystem Sulfur oxidation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YF11 at UniProt or InterPro

Protein Sequence (165 amino acids)

>RR42_RS19665 alkyl hydroperoxide reductase (Cupriavidus basilensis FW507-4G11)
MRRARVLLLLAALAWSGAAAALEVGDTVRLPPVQLLDGRVLTPADLAGRPLVVEVWASWC
PFCALQNPRLQKLFESTGGARGGLQVLALSIDKDPRDATAYMAKHGYTFPAAMDTPALRA
ALGKRRGLPELYVIDAHGKVVQKEVGEMLEEEVAALARYATPTQK