Protein Info for RR42_RS19450 in Cupriavidus basilensis FW507-4G11

Annotation: potassium transporter KefC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 604 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 31 to 50 (20 residues), see Phobius details amino acids 56 to 75 (20 residues), see Phobius details amino acids 87 to 109 (23 residues), see Phobius details amino acids 115 to 135 (21 residues), see Phobius details amino acids 148 to 171 (24 residues), see Phobius details amino acids 183 to 206 (24 residues), see Phobius details amino acids 222 to 255 (34 residues), see Phobius details amino acids 273 to 293 (21 residues), see Phobius details amino acids 299 to 321 (23 residues), see Phobius details amino acids 328 to 355 (28 residues), see Phobius details amino acids 361 to 381 (21 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 11 to 377 (367 residues), 201.5 bits, see alignment E=1.9e-63 TIGR00932: transporter, monovalent cation:proton antiporter-2 (CPA2) family" amino acids 14 to 288 (275 residues), 280.4 bits, see alignment E=8.6e-88 PF02254: TrkA_N" amino acids 407 to 517 (111 residues), 85.7 bits, see alignment E=3.1e-28

Best Hits

KEGG orthology group: K11745, glutathione-regulated potassium-efflux system ancillary protein KefC (inferred from 87% identity to cti:RALTA_A2980)

Predicted SEED Role

"Glutathione-regulated potassium-efflux system protein KefC" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y7B5 at UniProt or InterPro

Protein Sequence (604 amino acids)

>RR42_RS19450 potassium transporter KefC (Cupriavidus basilensis FW507-4G11)
MEQHDFLVALVVFLVAAVVAVPVARRFGLGAVLGYLLAGVAIGPWALRLVTNVESILHFS
EFGVVLMMFVIGLELEPKKLWALRRVIFGYGGAQMAACALLLGGAAALVGASWQVALVAG
LGLALSSTAIALATLTERNLFGTPAGSASFGILLFQDIAAIPMIALLPLLAAGGADAGAS
GAAGWLGAAKAVGVIGAVVVGGRYLVRPALRFIARTDMREMFTAFALLLVVGIALMMDAV
GLSMALGTFLAGVLLADSEYRHALEADLEPFKGLLLGLFFMAVGMSIDFGVLMHAPVRVA
ALVIGFVLLKTLVLALLAPRFGIARGQWLLFALLISQGGEFAFVVFGVAGGAGLLPARTE
ALLVLVVALSMVATPLLLLAFDRLVAPRLARLARRPDDVIAPQDNPVLIAGFGRFGQIIG
RLLYAQGIGVTVLDHDPDQIEFLRQYDFKVFYGDATRMDLLESAGAERARILVVAIDGME
DSLALIDSVRARFPHLQIYARARHVSHVYQLKDRGVHLFEREVFEGSLLLGRRVLEGLGY
DPVQARSVALRFRRHNIAAIERFYPHYTDQKKLVSLARQARDELEEMFRQDRDQRRQREE
EDWS