Protein Info for RR42_RS19030 in Cupriavidus basilensis FW507-4G11

Annotation: ferrous iron transporter B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 214 transmembrane" amino acids 26 to 48 (23 residues), see Phobius details PF05137: PilN" amino acids 105 to 185 (81 residues), 80.8 bits, see alignment E=3e-27

Best Hits

KEGG orthology group: K02663, type IV pilus assembly protein PilN (inferred from 76% identity to reu:Reut_A3134)

Predicted SEED Role

"Type IV pilus biogenesis protein PilN" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YEJ0 at UniProt or InterPro

Protein Sequence (214 amino acids)

>RR42_RS19030 ferrous iron transporter B (Cupriavidus basilensis FW507-4G11)
MPTNSIPTVNLLPYHEARRASRRKKVYALLGGAAGAGALVVLLGGMYIDHRVDAVSSLNQ
VLLAENNRMDGQIREVNSLRKDIEGLLQRQKAIEGLQNERNRPVQLLEELVRQVPEGVYL
TTLKQTGDAFTVTGIAQSNERVSELLRNLSQVQWLDKAELGESKAVMMTNNLREQRRLFD
FSMRFAYRAPQAPEDGKKGKAGLAGASAPAGGKG