Protein Info for RR42_RS18935 in Cupriavidus basilensis FW507-4G11

Annotation: metal-dependent hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 transmembrane" amino acids 14 to 33 (20 residues), see Phobius details amino acids 44 to 66 (23 residues), see Phobius details amino acids 77 to 97 (21 residues), see Phobius details amino acids 126 to 152 (27 residues), see Phobius details amino acids 159 to 184 (26 residues), see Phobius details amino acids 196 to 218 (23 residues), see Phobius details amino acids 246 to 268 (23 residues), see Phobius details PF01061: ABC2_membrane" amino acids 29 to 239 (211 residues), 136.8 bits, see alignment E=7.9e-44 PF12698: ABC2_membrane_3" amino acids 76 to 261 (186 residues), 42.3 bits, see alignment E=5.4e-15

Best Hits

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 93% identity to reh:H16_A3420)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YH10 at UniProt or InterPro

Protein Sequence (276 amino acids)

>RR42_RS18935 metal-dependent hydrolase (Cupriavidus basilensis FW507-4G11)
MKMPTEFDGTQDAINTHLAPMAVGGLVGFRTLLYKEVLRFWKVSFQTVAAPVLTAILYLL
IFGHVLENRVKVYDQISYTAFLVPGLVMMSVLQNAFANSSSSLIQSKITGNLVFIMLPPL
SHWEMFGAYVVASIVRGLAVGLGVLLVTAWFANLHFANIAWILVFAVLGAAILGTLGLIA
GIWAEKFDQLAAFQNFLIMPATFLSGVFYSIHSLPAFWQAVSHANPFFYMIDGFRYGFFG
VSDVAPGFSLAVVGTAFVVLATVALQLLKSGYKLRH