Protein Info for RR42_RS18830 in Cupriavidus basilensis FW507-4G11

Annotation: large-conductance mechanosensitive channel

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 143 signal peptide" amino acids 1 to 15 (15 residues), see Phobius details amino acids 30 to 31 (2 residues), see Phobius details transmembrane" amino acids 16 to 29 (14 residues), see Phobius details amino acids 82 to 105 (24 residues), see Phobius details TIGR00220: large conductance mechanosensitive channel protein" amino acids 3 to 140 (138 residues), 129.6 bits, see alignment E=4.1e-42 PF01741: MscL" amino acids 3 to 139 (137 residues), 150.1 bits, see alignment E=1.9e-48

Best Hits

Swiss-Prot: 84% identical to MSCL_CUPMC: Large-conductance mechanosensitive channel (mscL) from Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)

KEGG orthology group: K03282, large conductance mechanosensitive channel (inferred from 84% identity to rme:Rmet_3231)

Predicted SEED Role

"Large-conductance mechanosensitive channel" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YEG5 at UniProt or InterPro

Protein Sequence (143 amino acids)

>RR42_RS18830 large-conductance mechanosensitive channel (Cupriavidus basilensis FW507-4G11)
MGMMSEFKAFAMRGNVIDLAVGVIIGAAFGKIVDSVVNDLIMPVVGRIIGKLDFSNLFVV
LSEPPAGVPHTLDALRKAGIPVFAYGNFLTILVNFIILAFIIFMMVRAIMKMRAAEPPPA
PAATPEDVVLLREIRDSLKARQP