Protein Info for RR42_RS18490 in Cupriavidus basilensis FW507-4G11

Annotation: 3-octaprenyl-4-hydroxybenzoate carboxy-lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00421: polyprenyl P-hydroxybenzoate and phenylacrylic acid decarboxylases
  • amino acids 14 to 195 (182 residues), 236.9 bits, E=6.5e-75
• PF02441: Flavoprotein
  • amino acids 14 to 184 (171 residues), 144.2 bits, E=1.4e-46

Best Hits

Swiss-Prot: 54% identical to UBIX_NEIMB: Flavin prenyltransferase UbiX (ubiX) from Neisseria meningitidis serogroup B (strain MC58)

KEGG orthology group: K03186, 3-octaprenyl-4-hydroxybenzoate carboxy-lyase UbiX [EC: 4.1.1.-] (inferred from 86% identity to reh:H16_A3344)

MetaCyc: 52% identical to flavin prenyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-16937 [EC: 2.5.1.129]

Predicted SEED Role

"3-polyprenyl-4-hydroxybenzoate carboxy-lyase UbiX (EC 4.1.1.-)" in subsystem Ubiquinone Biosynthesis (EC 4.1.1.-)

MetaCyc Pathways

• superpathway of chorismate metabolism (45/59 steps found)
• superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (10/12 steps found)
• ubiquinol-8 biosynthesis (early decarboxylation) (6/8 steps found)
• prenylated FMNH₂ biosynthesis (1/3 steps found)

KEGG Metabolic Maps

• 1,1,1-Trichloro-2,2-bis(4-chlorophenyl)ethane (DDT) degradation
• 1- and 2-Methylnaphthalene degradation
• 3-Chloroacrylic acid degradation
• Ascorbate and aldarate metabolism
• Benzoate degradation via hydroxylation
• Biphenyl degradation
• Fluorene degradation
• Phenylalanine metabolism
• Phenylpropanoid biosynthesis
• Purine metabolism
• Pyruvate metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.-

Use Curated BLAST to search for 2.5.1.129 or 4.1.1.-

Sequence Analysis Tools

See A0A0C4Y6V0 at UniProt or InterPro

Protein Sequence (202 amino acids)

>RR42_RS18490 3-octaprenyl-4-hydroxybenzoate carboxy-lyase (Cupriavidus basilensis FW507-4G11)
MTAAGAAGEGKPRRIVVAITGATGAVYGVRLVQILGAAPGVEAHLLISAAGVMNLQHELD
ISKAEVEAFAQVVHNVRDIGATIASGSFAAHAMVVAPCSMRTLAAVAHGLSDNLITRAAD
VTLKERRKLVLMVRETPLNLAHLRNMTAVTEMGGIIFPPVPGFYQKPQSVAELVDHTVGR
VLDLIDVPQTLAPSWAGLNGQA