Protein Info for RR42_RS18480 in Cupriavidus basilensis FW507-4G11

Annotation: SAM-dependent methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 TIGR00536: methyltransferase, HemK family" amino acids 31 to 295 (265 residues), 234.6 bits, see alignment E=1.3e-73 PF17827: PrmC_N" amino acids 35 to 93 (59 residues), 58.3 bits, see alignment E=4.2e-19 TIGR03534: protein-(glutamine-N5) methyltransferase, release factor-specific" amino acids 43 to 293 (251 residues), 285.9 bits, see alignment E=2.8e-89 PF03602: Cons_hypoth95" amino acids 111 to 210 (100 residues), 25.8 bits, see alignment E=3.5e-09 PF01170: UPF0020" amino acids 117 to 210 (94 residues), 27.8 bits, see alignment E=8.8e-10 PF05175: MTS" amino acids 130 to 211 (82 residues), 56.4 bits, see alignment E=1.4e-18 PF06325: PrmA" amino acids 133 to 205 (73 residues), 28.3 bits, see alignment E=5.5e-10 PF13847: Methyltransf_31" amino acids 133 to 211 (79 residues), 51.1 bits, see alignment E=5.8e-17 PF13649: Methyltransf_25" amino acids 134 to 205 (72 residues), 44.8 bits, see alignment E=7.4e-15 PF08241: Methyltransf_11" amino acids 135 to 205 (71 residues), 27.2 bits, see alignment E=2.2e-09

Best Hits

Swiss-Prot: 56% identical to PRMC_BURPS: Release factor glutamine methyltransferase (prmC) from Burkholderia pseudomallei (strain K96243)

KEGG orthology group: K02493, methyltransferase [EC: 2.1.1.-] (inferred from 73% identity to cti:RALTA_A2797)

MetaCyc: 46% identical to protein-(glutamine-N5) methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-14992 [EC: 2.1.1.297]

Predicted SEED Role

"Protein-N(5)-glutamine methyltransferase PrmC, methylates polypeptide chain release factors RF1 and RF2"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.297

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YED0 at UniProt or InterPro

Protein Sequence (305 amino acids)

>RR42_RS18480 SAM-dependent methyltransferase (Cupriavidus basilensis FW507-4G11)
MPSIMSTATSPSPNAATPVSLPETATVRDALAVAAAAGLPALEARLLISHVTGLTRTQLI
TRDGETLAPAQRESVAALLGRRLGGEPVAYLLGEREFFGRAFRVTPDVLIPRPDTEIAVE
AALKLLAPLAVPRVLDMGTGSGALAVTLACERPDAEVWATDISPGALQVAQDNARALGAG
NVRFLASDWYAALPAGLRFDLIVSNPPYIAAADPHLGQGDLRFEPIDALTDHGDGLSDLG
AIVAGAAARLHAGGWLLMEHGYDQGQAARDLLAAAGMAEIFTARDLAGHERCSAARLPAQ
AGTAA