Protein Info for RR42_RS18320 in Cupriavidus basilensis FW507-4G11

Annotation: uracil-DNA glycosylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 TIGR00628: uracil-DNA glycosylase" amino acids 45 to 258 (214 residues), 245.2 bits, see alignment E=3e-77 PF03167: UDG" amino acids 88 to 255 (168 residues), 71.3 bits, see alignment E=4.9e-24

Best Hits

Swiss-Prot: 67% identical to UNG_RALSO: Uracil-DNA glycosylase (ung) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K03648, uracil-DNA glycosylase [EC: 3.2.2.-] (inferred from 78% identity to reu:Reut_A3028)

Predicted SEED Role

"Uracil-DNA glycosylase, family 1" in subsystem DNA Repair Base Excision

Isozymes

Compare fitness of predicted isozymes for: 3.2.2.-

Use Curated BLAST to search for 3.2.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YKD2 at UniProt or InterPro

Protein Sequence (267 amino acids)

>RR42_RS18320 uracil-DNA glycosylase (Cupriavidus basilensis FW507-4G11)
MTKHNSAQADLFAAPAVAAAETENATAPAPAAASLLEQAAALPAAWRALLAPCMNTAGWQ
ELAAFVDGERASGKPVFPHDVFHALHLTPPETVKVVILGQDPYHGTGVVNGSEIPQAHGL
AFSVPDGVRVPPSLRNIFKEIAAEYEGGAVPASGNLEGWARQGVLLLNTVLTVEQGQAAS
HARRGWEAVTDCLIQALSAARPHLVFLLWGSHAQAKKPLLAGTHCVLEAPHPSPLSAHRG
FLGCGHFRLANDWLQRHGAAPVDWRAT