Protein Info for RR42_RS18190 in Cupriavidus basilensis FW507-4G11

Annotation: peptide ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF00005: ABC_tran" amino acids 64 to 214 (151 residues), 99.6 bits, see alignment E=2.5e-32 TIGR01727: oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain" amino acids 264 to 350 (87 residues), 92.1 bits, see alignment E=9.2e-31 PF08352: oligo_HPY" amino acids 266 to 330 (65 residues), 69.5 bits, see alignment E=2.6e-23

Best Hits

Swiss-Prot: 54% identical to APPF_BACSU: Oligopeptide transport ATP-binding protein AppF (appF) from Bacillus subtilis (strain 168)

KEGG orthology group: K02032, peptide/nickel transport system ATP-binding protein (inferred from 92% identity to cti:RALTA_A2749)

MetaCyc: 45% identical to dipeptide ABC transporter ATP binding subunit DppF (Escherichia coli K-12 substr. MG1655)
ABC-8-RXN [EC: 7.4.2.9]

Predicted SEED Role

"Oligopeptide transport ATP-binding protein OppF (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YGK1 at UniProt or InterPro

Protein Sequence (354 amino acids)

>RR42_RS18190 peptide ABC transporter ATP-binding protein (Cupriavidus basilensis FW507-4G11)
MSAAVVDPALAAMTTDSSAEPTPNAPILELQGVSKRFVKSLDAAAKIANLFGAGAKEEVV
HAVDRVDLSIRAGEVVGLVGESGCGKSTLGRMAVGLHSLTEGSRLWRGVDLDRLPPEKKR
EKQLAIQMIFQDPYASLNPRLRVMDIVGEAPVVHGMVPASEQKRYVEDMLVRVGMDPTVL
RRFPHQFSGGQRARIGIARALAVKPEFLVCDESVAALDVSIQAQVLNLFMRLRQDLNLTY
LFISHDLGVVKHISDRVVIMYLGRVVESAPAEDVFASPNHPYTQALLAEAPKLEVGKKTF
VAIKGEIPSPLNPPPGCHFHPRCPHAMPRCREEQPLLKEIAPMRFSACHLNDMA