Protein Info for RR42_RS18095 in Cupriavidus basilensis FW507-4G11

Annotation: UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D- alanine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01225: Mur_ligase
  • amino acids 35 to 105 (71 residues), 42.5 bits, E=1e-14
• TIGR01143: UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase
  • amino acids 37 to 464 (428 residues), 420.5 bits, E=3.7e-130
• PF08245: Mur_ligase_M
  • amino acids 115 to 308 (194 residues), 135.7 bits, E=3.2e-43
• PF02875: Mur_ligase_C
  • amino acids 328 to 400 (73 residues), 53.2 bits, E=4.6e-18

Best Hits

KEGG orthology group: K01929, UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate--D-alanyl-D-alanine ligase [EC: 6.3.2.10] (inferred from 80% identity to reu:Reut_A2983)

Predicted SEED Role

"UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate--D-alanyl-D-alanine ligase (EC 6.3.2.10)" in subsystem Methicillin resistance in Staphylococci or Peptidoglycan Biosynthesis (EC 6.3.2.10)

MetaCyc Pathways

• peptidoglycan biosynthesis I (meso-diaminopimelate containing) (11/12 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis I (meso-diaminopimelate containing) (8/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis II (lysine-containing) (7/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis III (meso-diaminopimelate containing) (6/8 steps found)
• peptidoglycan biosynthesis III (mycobacteria) (11/15 steps found)
• peptidoglycan biosynthesis II (staphylococci) (12/17 steps found)
• peptidoglycan biosynthesis IV (Enterococcus faecium) (12/17 steps found)
• peptidoglycan biosynthesis V (β-lactam resistance) (11/17 steps found)

KEGG Metabolic Maps

• Lysine biosynthesis
• Peptidoglycan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.10

Sequence Analysis Tools

See A0A0C4YGH0 at UniProt or InterPro

Protein Sequence (471 amino acids)

>RR42_RS18095 UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D- alanine ligase (Cupriavidus basilensis FW507-4G11)
MTQYTMTDLQQAAGWIAGARLSGPDGAGSRGFSRVLTDSRTVQPGDLFVALKGERFDAHD
FLADVVARGAAAVLVDREPDAALGIPAIVVPDTRLALGQLAAGWRRRFSLPAVAVTGSNG
KTTVKEMIAAIFAAAVGEGARLATGGNLNNDIGLPLTVLRLSAAHRLAVLELGMNHPGET
VYLASIAQPTVAVVTNAQREHQEFMVNVEAVAHEHAAAIAALPADGVAVFPLDAEGGGAH
AGIWRQAAGARRVLSFGLDASADVRADVALDDGVQVMQVSAPGAAFEVRLSVLGTHNVRN
ALAAIACALGAGVGIEAIQAGLAGFAAVKGRLQVKHATGGTLVIDDSYNANPDSVRAAID
VLAGFAAPRLLVLGDMGEVGDQGPAFHTEIGAYARAHGIESLWATGAAMVHAVQAFGAAA
RYFERAEDLAQVLAQDKDGTVAAASAVLVKGSRFMRMERMVDALVANTPAH