Protein Info for RR42_RS17990 in Cupriavidus basilensis FW507-4G11

Annotation: methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 transmembrane" amino acids 17 to 38 (22 residues), see Phobius details amino acids 113 to 128 (16 residues), see Phobius details amino acids 134 to 152 (19 residues), see Phobius details amino acids 163 to 181 (19 residues), see Phobius details amino acids 186 to 205 (20 residues), see Phobius details amino acids 224 to 253 (30 residues), see Phobius details amino acids 263 to 286 (24 residues), see Phobius details PF06750: A24_N_bact" amino acids 25 to 130 (106 residues), 109.7 bits, see alignment E=6e-36 PF01478: Peptidase_A24" amino acids 140 to 249 (110 residues), 102.1 bits, see alignment E=2.2e-33

Best Hits

Swiss-Prot: 57% identical to LEP4_AERHY: Type 4 prepilin-like proteins leader peptide-processing enzyme (tapD) from Aeromonas hydrophila

KEGG orthology group: K02654, leader peptidase (prepilin peptidase) / N-methyltransferase [EC: 2.1.1.- 3.4.23.43] (inferred from 80% identity to reu:Reut_A2962)

MetaCyc: 56% identical to prepilin leader peptidase/N-methyltransferase (Pseudomonas aeruginosa)
Prepilin peptidase. [EC: 3.4.23.43]; 2.1.1.- [EC: 3.4.23.43]

Predicted SEED Role

"Leader peptidase (Prepilin peptidase) (EC 3.4.23.43) / N-methyltransferase (EC 2.1.1.-)" in subsystem Type IV pilus (EC 2.1.1.-, EC 3.4.23.43)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-, 3.4.23.43

Use Curated BLAST to search for 2.1.1.- or 3.4.23.43

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y6H3 at UniProt or InterPro

Protein Sequence (290 amino acids)

>RR42_RS17990 methyltransferase (Cupriavidus basilensis FW507-4G11)
MAAPAQTIAELAALPPWFLVAAAALIGLLVGSFLNVVVHRLPRMMEHDEANYIASLRDDP
IPHPEPYNLMVPRSACPHCGHAIGALENIPVLSYLFLRGRCSSCAAPIGARYPLVEAGTA
LLTALATAHFGPTWQALAAIALIWALIALTLIDADTQLLPDQITLPLVWLGLLLNLGGLF
APLADAVIGAAAGYLLLWTVYWIFKLVRGKEGMGYGDFKLMGALGAWFGWQALPALVLLS
SVVGLVFALANIALRRQDRDTHFAFGPYIAGAGLLVLFFGPNVLPLGIVG