Protein Info for RR42_RS17890 in Cupriavidus basilensis FW507-4G11

Annotation: signal recognition particle protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 464 TIGR00959: signal recognition particle protein" amino acids 3 to 438 (436 residues), 570.7 bits, see alignment E=9.7e-176 PF02881: SRP54_N" amino acids 5 to 82 (78 residues), 62 bits, see alignment E=1.5e-20 PF06414: Zeta_toxin" amino acids 106 to 151 (46 residues), 24.8 bits, see alignment 4e-09 PF00448: SRP54" amino acids 108 to 304 (197 residues), 243.5 bits, see alignment E=4.6e-76 PF13401: AAA_22" amino acids 109 to 218 (110 residues), 29 bits, see alignment E=3.6e-10 PF02978: SRP_SPB" amino acids 336 to 436 (101 residues), 112.5 bits, see alignment E=3.1e-36

Best Hits

KEGG orthology group: K03106, signal recognition particle subunit SRP54 (inferred from 95% identity to reu:Reut_A2947)

Predicted SEED Role

"Signal recognition particle, subunit Ffh SRP54 (TC 3.A.5.1.1)" in subsystem Two cell division clusters relating to chromosome partitioning or Universal GTPases (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YK18 at UniProt or InterPro

Protein Sequence (464 amino acids)

>RR42_RS17890 signal recognition particle protein (Cupriavidus basilensis FW507-4G11)
MLDNLTQRLARVVKTMRGEARLTEANTAEMLREVRLAMLEADVALPVVREFIARVKEKAL
GEDVVSSLTPGQALVGVVQRELTAVIGGEESLSADNKSGELNLAVQPPAIILMAGLQGAG
KTTTVGKLAKWLKENKKKKVLTVSCDVYRPAAIAQLKTVSEQVGADFFPSEPDQKPVDIA
RAAVDWARKHYHDVLIVDTAGRLGIDEAMMQEIAALHAEIKPVETLFVVDAMLGQDAVNT
ARAFNDALPLTGVVLTKLDGDARGGAALSVRHITGRPIKFVGVGEKLDGLEPFYPDRMAQ
RILGMGDILALVEEAQRGVDMEAAEKLAKKIKKTGDFDLEDFKAQIGQMKKMGGLGSLVD
KLPAQFAQQAQGANMDVAEKQVRRMEGIINSMTAAERAKPDLIKASRKRRIATGAGVPVQ
EVNRLLNQFDQMQSMMKKLKGGGMMKMMRSMGAMKGGMKGLFNR