Protein Info for RR42_RS17865 in Cupriavidus basilensis FW507-4G11

Annotation: N-acetyl-anhydromuranmyl-L-alanine amidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01510: Amidase_2
  • amino acids 45 to 184 (140 residues), 107.2 bits, E=4e-35

Best Hits

Swiss-Prot: 54% identical to AMPD_SALTS: 1,6-anhydro-N-acetylmuramyl-L-alanine amidase AmpD (ampD) from Salmonella typhimurium (strain SL1344)

KEGG orthology group: K03806, AmpD protein (inferred from 80% identity to reh:H16_A3236)

MetaCyc: 59% identical to N-acetylmuramoyl-L-alanine amidase (Pseudomonas aeruginosa PAO1)
N-acetylmuramoyl-L-alanine amidase. [EC: 3.5.1.28]

Predicted SEED Role

"N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) AmpD" (EC 3.5.1.28)

MetaCyc Pathways

• peptidoglycan recycling I (10/14 steps found)
• peptidoglycan recycling II (7/10 steps found)

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.28

Use Curated BLAST to search for 3.5.1.28

Sequence Analysis Tools

See A0A0C4YK11 at UniProt or InterPro

Protein Sequence (209 amino acids)

>RR42_RS17865 N-acetyl-anhydromuranmyl-L-alanine amidase (Cupriavidus basilensis FW507-4G11)
MPDLDQAAQAAQSAPGSRFVPDPAGWVPAARQVPSPNFDARPAHMPVDLVVIHNISLPPG
QFGSGDIEAFFLNRLDPSRHPFFETIHQVRVSAHFLVTRGGELVQFVSCLDRAWHAGQSE
FFGRPRCNDFSIGIEVEGSDDQPFTLAQYHTTAALVRALLGTYPVRAVAGHSDIAPGRKT
DPGPHFDWAGFAAAAGVAPAQLPYRKEQP