Protein Info for RR42_RS17505 in Cupriavidus basilensis FW507-4G11

Annotation: NAD synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 486 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 35 to 53 (19 residues), see Phobius details amino acids 73 to 91 (19 residues), see Phobius details amino acids 103 to 123 (21 residues), see Phobius details amino acids 144 to 165 (22 residues), see Phobius details amino acids 187 to 206 (20 residues), see Phobius details amino acids 213 to 233 (21 residues), see Phobius details amino acids 262 to 281 (20 residues), see Phobius details amino acids 289 to 309 (21 residues), see Phobius details amino acids 323 to 342 (20 residues), see Phobius details PF02233: PNTB" amino acids 7 to 482 (476 residues), 630.6 bits, see alignment E=8.8e-194

Best Hits

Swiss-Prot: 61% identical to PNTB_RHORT: NAD(P) transhydrogenase subunit beta (pntB) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K00325, NAD(P) transhydrogenase subunit beta [EC: 1.6.1.2] (inferred from 91% identity to reh:H16_A3131)

Predicted SEED Role

"NAD(P) transhydrogenase subunit beta (EC 1.6.1.2)" in subsystem Phosphate metabolism (EC 1.6.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.1.2

Use Curated BLAST to search for 1.6.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YG15 at UniProt or InterPro

Protein Sequence (486 amino acids)

>RR42_RS17505 NAD synthetase (Cupriavidus basilensis FW507-4G11)
MSMNLVTLLYLLASVCFIQALKGLSHPSSARRGNAFGMIGMAIAAVTTLVLIAKLKSEFL
AIGAGQSSVAEGMALIFGALVVGGGIGAYVARKVEMTKMPELVAAMHSLIGMAAVCIAVA
VVAEPSAFSITPPGSHDIPFGNRIELFIGCFVGAITFSGSVIAFGKLSGKYKFRLFQGAP
VSFAGQHLLNLLLAVAMIGFGIIFCLSQDWLPFLLMLAIAFVLGVLIIIPIGGADMPVVV
SMLNSYSGWAAAGIGFSLNNPMLIIAGSLVGSSGAILSYIMCKAMNRSFFNVLLGGFGGA
PAAAAAGGQAQRNVKSGSADDAAFLMGNAETVIIVPGYGLAVARAQHALKELTEKLVERG
VTVKYAIHPVAGRMPGHMNVLLAEAEVPYDQVFEMEDINSEFGQADVVLVLGANDVVNPA
AKTDPNSPIAGMPILEAYKAKTIIVNKRSMAAGYAGLDNELFYMDKTMMVFGDAKKVVED
MGKAVE