Protein Info for RR42_RS17305 in Cupriavidus basilensis FW507-4G11

Annotation: ion transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 transmembrane" amino acids 45 to 66 (22 residues), see Phobius details amino acids 75 to 94 (20 residues), see Phobius details amino acids 105 to 127 (23 residues), see Phobius details amino acids 145 to 152 (8 residues), see Phobius details amino acids 171 to 192 (22 residues), see Phobius details amino acids 204 to 219 (16 residues), see Phobius details amino acids 230 to 256 (27 residues), see Phobius details PF00520: Ion_trans" amino acids 44 to 253 (210 residues), 102.9 bits, see alignment E=1.7e-33 PF07885: Ion_trans_2" amino acids 178 to 253 (76 residues), 50.8 bits, see alignment E=1.2e-17

Best Hits

KEGG orthology group: None (inferred from 82% identity to reh:H16_A3095)

Predicted SEED Role

"Potassium voltage-gated channel subfamily KQT; possible potassium channel, VIC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YDB3 at UniProt or InterPro

Protein Sequence (323 amino acids)

>RR42_RS17305 ion transporter (Cupriavidus basilensis FW507-4G11)
MAAPNATQRARSSAQTRQRLGKPESGWRERWYTIIFEADTRNGQLFDITLLLAIVASVLI
VMFDSLPAVNLRLGRVFTVLEWLFTLLFTAEYLMRIVVVRRPLRYVFSFFGVVDFLSIIP
TWLAFFVPELAFLIDVRLLRLLRVFRILKLTVYFEEAQILYRALANSRRKIFVFLGTVFI
ITVILGTVMYVVEGPQHGFTSIPVSMYWAVVTLTTTGFGDMVPKTPLGQFITSLTILLGY
GIIAFPTGIVGAELAASIMKRPLTTRTCSHCLTQGHDPDAGYCKHCGSELPPYQGEDKGE
GEREPAGLRASAQTPPRRPTSSA