Protein Info for RR42_RS17245 in Cupriavidus basilensis FW507-4G11

Annotation: deoxynucleoside kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 213 PF01712: dNK" amino acids 8 to 200 (193 residues), 105 bits, see alignment E=7.6e-34 PF13671: AAA_33" amino acids 8 to 162 (155 residues), 33 bits, see alignment E=1.1e-11

Best Hits

KEGG orthology group: K00904, deoxyguanosine kinase [EC: 2.7.1.113] (inferred from 74% identity to rme:Rmet_2916)

Predicted SEED Role

"Deoxyadenosine kinase (EC 2.7.1.76) / Deoxyguanosine kinase (EC 2.7.1.113)" in subsystem Purine conversions or PnuC-like transporters (EC 2.7.1.113, EC 2.7.1.76)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.113 or 2.7.1.76

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YJK2 at UniProt or InterPro

Protein Sequence (213 amino acids)

>RR42_RS17245 deoxynucleoside kinase (Cupriavidus basilensis FW507-4G11)
MLEHLRRIVVEGPIGAGKTALAQRLAQTLRTGELLDAARENPFLERYYREPARYALPLQL
SLMNQRAQQLMAWQAALLAGQRMVGDFLHNKDRLYAGLTLPEDELALYDALAARLPAQGQ
RVDLVIVLQASPALLRERIARRNAPGESSIDDAYLERLSDAYGELFHRYDEAPVMIVDTA
HFSPVDNDADFRTLLSRIENMRGRKAFLNLAAP