Protein Info for RR42_RS17230 in Cupriavidus basilensis FW507-4G11

Annotation: phosphoserine phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01488: HAD phosphoserine phosphatase-like hydrolase, family IB
  • amino acids 3 to 197 (195 residues), 60.6 bits, E=1.9e-20
• TIGR01490: HAD hydrolase, family IB
  • amino acids 3 to 208 (206 residues), 116.7 bits, E=1.7e-37
• PF12710: HAD
  • amino acids 4 to 195 (192 residues), 129.2 bits, E=1.3e-41

Best Hits

KEGG orthology group: None (inferred from 87% identity to cti:RALTA_A2555)

Predicted SEED Role

"Phosphoserine phosphatase (EC 3.1.3.3)" in subsystem Glycine and Serine Utilization or Serine Biosynthesis (EC 3.1.3.3)

MetaCyc Pathways

• superpathway of sulfate assimilation and cysteine biosynthesis (9/9 steps found)
• superpathway of L-serine and glycine biosynthesis I (4/4 steps found)
• L-serine biosynthesis I (3/3 steps found)

KEGG Metabolic Maps

• Glycine, serine and threonine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.3

Use Curated BLAST to search for 3.1.3.3

Sequence Analysis Tools

See A0A0C4YD98 at UniProt or InterPro

Protein Sequence (224 amino acids)

>RR42_RS17230 phosphoserine phosphatase (Cupriavidus basilensis FW507-4G11)
MNLALFDLDHTLLPTDSDHEWGRFLVRLGVVDEEFYRRRNDEFFGHYKAGTLDIQAFLRF
ALAPLAANPRDRLEALRSQFMREVIDPVITPQARALVYKHLDAGDLCAVVTATNSFVTAP
ITAAFGIKHLIATEPATANGKPDGAFTGEVAGIPSFREGKIARVEAWLKSMGTQWDAFEN
TTFYSDSANDLPLLEKVSEPIAANPDDRLRHHAAASGWRIMDLF