Protein Info for RR42_RS17175 in Cupriavidus basilensis FW507-4G11

Annotation: ornithine carbamoyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00658: ornithine carbamoyltransferase
  • amino acids 7 to 303 (297 residues), 353.8 bits, E=3.8e-110
• PF02729: OTCace_N
  • amino acids 7 to 146 (140 residues), 169.1 bits, E=6.8e-54
• PF00185: OTCace
  • amino acids 154 to 301 (148 residues), 173.8 bits, E=2.9e-55

Best Hits

Swiss-Prot: 94% identical to OTC_CUPTR: Ornithine carbamoyltransferase (arcB) from Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CIP 107171 / LMG 19424 / R1)

KEGG orthology group: None (inferred from 95% identity to reh:H16_A3063)

MetaCyc: 44% identical to ornithine carbamoyltransferase (Arabidopsis thaliana col)
Ornithine carbamoyltransferase. [EC: 2.1.3.3]

Predicted SEED Role

"Ornithine carbamoyltransferase (EC 2.1.3.3)" in subsystem Arginine Biosynthesis extended or Arginine Deiminase Pathway or Arginine and Ornithine Degradation (EC 2.1.3.3)

MetaCyc Pathways

• L-arginine biosynthesis II (acetyl cycle) (10/10 steps found)
• superpathway of arginine and polyamine biosynthesis (15/17 steps found)
• L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
• L-citrulline degradation (3/3 steps found)
• L-citrulline biosynthesis (6/8 steps found)
• L-arginine degradation V (arginine deiminase pathway) (3/4 steps found)
• L-arginine degradation XIII (reductive Stickland reaction) (3/5 steps found)
• urea cycle (3/5 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)
• L-arginine biosynthesis IV (archaea) (4/9 steps found)
• L-arginine degradation XIV (oxidative Stickland reaction) (1/6 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.3.3

Sequence Analysis Tools

See A0A0C4YJI6 at UniProt or InterPro

Protein Sequence (307 amino acids)

>RR42_RS17175 ornithine carbamoyltransferase (Cupriavidus basilensis FW507-4G11)
MSPTSIKHYLQFSDLTPDEYEYLLDRARILKTKFKNYETWHPLHDRTLSMIFEKNSTRTR
LSFEAGIHQLGGHAVFLNTRDSQLGRGEPIEDAAQVISRMVDIIMIRTFGQEIIERFAAH
SRVPVINGLTNEYHPCQVLADVFTYIEQRGSIRGKTVAWIGDANNMAYTWIQAAERLGFT
FHFSAPPGYQLDPAMVPATAAHLVKVFDDPLTACQGADLVTTDVWTSMGYEAENDARKRA
FQNWMVTTAMMDRAGDDALFMHCLPAHRGEEVEAAVIDGPKSVVWEEAENRLHVQKALME
YLLCGRY